DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HERC3 and HUWE1

DIOPT Version :9

Sequence 1:NP_055421.1 Gene:HERC3 / 8916 HGNCID:4876 Length:1050 Species:Homo sapiens
Sequence 2:NP_001285288.1 Gene:HUWE1 / 32510 FlyBaseID:FBgn0030674 Length:5151 Species:Drosophila melanogaster


Alignment Length:435 Identity:107/435 - (24%)
Similarity:193/435 - (44%) Gaps:51/435 - (11%)


- Green bases have known domain annotations that are detailed below.


Human   637 MKARPSIIQD--TVTLCSYPFIFDAQAKTKMLQTDAELQMQVAVNGANLQNVFMLLTLEPLLARS 699
            ::..|:.:.|  ...|..:..|.|...|.|..||:.|                   .|:..:.|.
  Fly  4747 LRQSPTHLSDGPFAVLVDHTRILDFDVKRKYFQTELE-------------------RLDEGIRRE 4792

Human   700 PFLVLHVRRNNLVGDALRELSIHSDIDLKKPLKVIFDGEEAVDAGGVTKEFFLLLLKELLNPIYG 764
            ...| .|||..:..|:.|.|......:.|....::|:.||..||||:.:|:::::.:|:.||:|.
  Fly  4793 EHTV-SVRRVTVFEDSFRVLYRLGPEEWKNRFYIVFEDEEGQDAGGLLREWYVIISREIFNPMYA 4856

Human   765 MFTYYQDSNLLWF---SDTCFVEH-NWFHLIGITCGLAIYNSTVVDLHFPLALYKKLLNVKPGLE 825
            :|.......:.:.   |......| ::|..:|.....|::::.:::.:|..:.||.:|.      
  Fly  4857 LFCVSPGDRVTYMINPSSHANPNHLSYFKFVGRVIAKAVHDNKLLECYFTRSFYKHILG------ 4915

Human   826 DLKELSPTEGRSLQELLDYPG------EDVEET-FCLNFTICRESYGVIEQKKLIPGGDNVTVCK 883
              |::..|:..| |:...|.|      .|:... :.|.|:...:.:||.:.:.|.|.|.:..|.:
  Fly  4916 --KQVKHTDMES-QDYEFYKGLDYLMKNDISTLGYELTFSTEVQEFGVTQIRDLKPNGRDTAVTE 4977

Human   884 DNRQEFVDAYVNYVFQISVHEWYTAFSSGFLKVCGGKVLELFQPSELRAMMVGNSNYNWEELEET 948
            :|:.|:|..........|:.:...||..||..:....::.:|...||..::.|..:.:.|:|:..
  Fly  4978 ENKFEYVQLVCQLKMSGSIRQQLDAFLEGFYDIIPKHLISIFNEQELELLISGLPDIDIEDLKAN 5042

Human   949 AIYKGDYSATHPTVKLFWETFHEFPLEKKKKFLLFLTGSDRIPIYGMASLQ-------IVIQSTA 1006
            ..|. .|::....::.||.....|....:.|||.|:||:.::|:.|..||:       ..|....
  Fly  5043 TEYH-KYTSKSAQIQWFWRALRSFDQADRAKFLQFVTGTSKVPLQGFGSLEGMNGIQKFQIHRDD 5106

Human  1007 SGEEYLPVAHTCYNLLDLPKYSSKEILSARLTQAL-DNYEGFSLA 1050
            ...:.||.||||:|.||||.|.|.:.|.:.|.:|: :..|||..|
  Fly  5107 RSTDRLPCAHTCFNQLDLPMYKSYDKLRSCLLKAIHECSEGFGFA 5151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HERC3NP_055421.1 RCC1 1 1..51
ATS1 2..331 CDD:227511
RCC1 2 52..101
RCC1 3 102..154
RCC1 4 156..207
RCC1 5 208..259
RCC1 6 261..311
RCC1 313..377 CDD:366085
RCC1 7 313..366
HECTc 702..1048 CDD:238033 93/364 (26%)
HUWE1NP_001285288.1 DUF908 90..326 CDD:283630
DUF913 621..989 CDD:283642
UBA_like_SF 1467..1506 CDD:304366
WWE 1756..1828 CDD:128922
40S_SA_C 3575..3651 CDD:292740
DUF4414 3675..3779 CDD:291075
HECTc 4796..5149 CDD:238033 93/363 (26%)
HECTc 4820..5148 CDD:214523 85/337 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.