DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HERC3 and CG42797

DIOPT Version :9

Sequence 1:NP_055421.1 Gene:HERC3 / 8916 HGNCID:4876 Length:1050 Species:Homo sapiens
Sequence 2:NP_572574.2 Gene:CG42797 / 31905 FlyBaseID:FBgn0261931 Length:1426 Species:Drosophila melanogaster


Alignment Length:518 Identity:142/518 - (27%)
Similarity:237/518 - (45%) Gaps:82/518 - (15%)


- Green bases have known domain annotations that are detailed below.


Human   579 IPVLFNNYITAALK---LLEKL--------------YKVN-LKVKHVE------YDTFYIPEISN 619
            :|:.:|..:.|.|:   :||.|              .|:| |:|:.|.      :|.    :::.
  Fly   943 VPIAYNEKVIAFLRQPNILEILRERQGQHTMSRQLREKINILRVEGVPALERLGHDL----QLTI 1003

Human   620 LVDIQEDYLMWF--LHQAGMKARPSIIQDTVTLCSYPFIFDAQAKTKMLQTDAELQMQVAVNGAN 682
            |:.:.|..:|.|  :.:...:..|.:..........||..|.:||.:......|.:.        
  Fly  1004 LLSLFEQEIMGFVPIEERSPQGSPVLNSRMPQRAPPPFRRDFEAKLRSFYRKLESKG-------- 1060

Human   683 LQNVFMLLTLEPLLARSPF-LVLHVRRNNLVGDALRELSIHSDIDLKK-PLKVIFDGEEAVDAGG 745
                         ..:.|. |.||:||::|:.||.|.:...:..||:: .|.|::|.||.:|.||
  Fly  1061 -------------YGQGPHKLKLHIRRSHLLEDAFRRIMSANKKDLQRGRLAVLWDTEEGLDYGG 1112

Human   746 VTKEFFLLLLKELLNPIYGMFTY-------YQDSNLLWFSDTCFVEHNWFHLIGITCGLAIYNST 803
            .::|||.||.:||.||.||:|.|       .|.|.|..|.|.|   |:||...|...|||:.:..
  Fly  1113 PSREFFFLLSRELFNPYYGLFEYSANDTYTVQVSPLSAFVDNC---HDWFRFSGRVLGLALVHQY 1174

Human   804 VVDLHFPLALYKKLLNVKPGLEDLKELSPTEGRSLQELLDY---PGEDVEETFCLNFTICRESYG 865
            ::|..|....||.||.:...|.||:.|.....:|||.:.|.   .|.|:..|||    :..|..|
  Fly  1175 LLDAFFTRPFYKALLRLPVALSDLESLDNEFHQSLQWIRDNDIGTGVDLGLTFC----VTEELLG 1235

Human   866 VIEQKKLIPGGDNVTVCKDNRQEFVDAYVNYVFQISVHEWYTAFSSGFLKVCGGKVLELFQPSEL 930
            .:..::|.|||.|:.:.:.|::|:::..:.:..:..|.|...:...||.:|...:::.:|...||
  Fly  1236 SVVDRELKPGGKNIIINEKNKKEYLERMIKWRLERGVQEQTESLVRGFYEVIDSRLVSVFDAREL 1300

Human   931 RAMMVGNSNYNWEELEETAIYKGDYSATHPTVKLFWETFHEFPLEKKKKFLLFLTGSDRIPIYGM 995
            ..::.|.:..:..:......|:..|...|..:..||:....|..|::.:.|.|:||:..||..|.
  Fly  1301 ELVIAGTAEIDTNDWRLNTEYRSGYHDNHQVIVWFWQVIERFSNEQRLRLLQFVTGTSSIPYEGF 1365

Human   996 ASLQIVIQSTASG----EEY-----LPVAHTCYNLLDLPKYSSKEILSARLTQALDNYEGFSL 1049
            ::|:   .||...    |::     ||.||||:|.||||.|.:.|:|..:|..|::....|.:
  Fly  1366 SALR---GSTGPRRFCIEKWGKPNALPRAHTCFNRLDLPPYPTPELLYEKLLLAVEETNTFGI 1425

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HERC3NP_055421.1 RCC1 1 1..51
ATS1 2..331 CDD:227511
RCC1 2 52..101
RCC1 3 102..154
RCC1 4 156..207
RCC1 5 208..259
RCC1 6 261..311
RCC1 313..377 CDD:366085
RCC1 7 313..366
HECTc 702..1048 CDD:238033 116/365 (32%)
CG42797NP_572574.2 WW 638..667 CDD:278809
HECTc 1068..1424 CDD:238033 116/365 (32%)
HECTc 1092..1423 CDD:214523 107/340 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.