DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CCNB1 and CycA

DIOPT Version :9

Sequence 1:NP_114172.1 Gene:CCNB1 / 891 HGNCID:1579 Length:433 Species:Homo sapiens
Sequence 2:NP_524030.2 Gene:CycA / 39340 FlyBaseID:FBgn0000404 Length:491 Species:Drosophila melanogaster


Alignment Length:473 Identity:129/473 - (27%)
Similarity:207/473 - (43%) Gaps:105/473 - (22%)


- Green bases have known domain annotations that are detailed below.


Human    12 NAENKAKINMAGAKRVPTAPAATSKPGLRPRTALGDIGNKVSEQLQAKMPMKKEAKPSATGKVI- 75
            |.||      .|.| :|.....|.:|       |..||.|..         |....|.|...|: 
  Fly    12 NKEN------PGIK-IPAGVKNTKQP-------LAVIGGKAE---------KNALAPRANFAVLN 53

Human    76 -DKKLPKPLEKVPM---------------------LVPV-------PVSEPVPEPEPEP------ 105
             :..:|:|..||.:                     :|||       .|.|...:.:..|      
  Fly    54 GNNNVPRPAGKVQVFRDVRNLNVDENVEYGAKKSNVVPVVEQFKTFSVYEDNNDTQVAPSGKSLA 118

Human   106 -----EPEPVK---------EEKLSPEPILV-DTASPSPMETSGCAPAEEDLCQAFSDVILAVND 155
                 |...||         :..|...|:.| |..||..::.|.....:.      ||:     .
  Fly   119 SLVDKENHDVKFGAGQKELVDYDLDSTPMSVTDVQSPMSVDRSILGVIQS------SDI-----S 172

Human   156 VDAEDGADPN----------------LCSEYVKDIYAYLRQLEEEQAVRPKYL-LGREVTGNMRA 203
            |..|.|..|.                ...:|..||..|.|:.|::...:|.|: ..::::.|||:
  Fly   173 VGTETGVSPTGRVKELPPRNDRQRFLEVVQYQMDILEYFRESEKKHRPKPLYMRRQKDISHNMRS 237

Human   204 ILIDWLVQVQMKFRLLQETMYMTVSIIDRFMQNNCVPKKMLQLVGVTAMFIASKYEEMYPPEIGD 268
            |||||||:|..:::|..||:|::|..:|||:....|.:..|||||..||:||:||||:||||:|:
  Fly   238 ILIDWLVEVSEEYKLDTETLYLSVFYLDRFLSQMAVVRSKLQLVGTAAMYIAAKYEEIYPPEVGE 302

Human   269 FAFVTDNTYTKHQIRQMEMKILRALNFGLGRPLPLHFLRRASKIGEVDVEQHTLAKYLMELTMLD 333
            |.|:||::|||.|:.:||..||:.|:|.|..|....|:...:.:.::..:...:..|:.||::::
  Fly   303 FVFLTDDSYTKAQVLRMEQVILKILSFDLCTPTAYVFINTYAVLCDMPEKLKYMTLYISELSLME 367

Human   334 YD-MVHFPPSQIAAGAFCLALKILDNGEWTPTLQHYLSYTEESLLPVMQHLAKNVVMVNQGLTKH 397
            .: .:.:.||.:::.:..||..||....|||.|:...:|..|.|..|:.||........:..|:.
  Fly   368 GETYLQYLPSLMSSASVALARHILGMEMWTPRLEEITTYKLEDLKTVVLHLCHTHKTAKELNTQA 432

Human   398 MTVKNKYATSKHAKISTL 415
            |  :.||....:.|::.:
  Fly   433 M--REKYNRDTYKKVAMM 448

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CCNB1NP_114172.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 19..47 6/27 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 93..116 6/42 (14%)
Interaction with CDK2 169..177 3/7 (43%)
Cyclin_N 173..298 CDD:278560 59/125 (47%)
Interaction with CDK2 258..261 2/2 (100%)
Cyclin_C 300..418 CDD:281044 26/117 (22%)
CycANP_524030.2 Cyclin_N 206..332 CDD:278560 59/125 (47%)
Cyclin_C 334..450 CDD:281044 26/117 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165146222
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D993640at2759
OrthoFinder 1 1.000 - - FOG0000121
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100199
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X94
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.650

Return to query results.
Submit another query.