DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AP1S2 and or

DIOPT Version :9

Sequence 1:NP_001259000.1 Gene:AP1S2 / 8905 HGNCID:560 Length:160 Species:Homo sapiens
Sequence 2:NP_536793.1 Gene:or / 43943 FlyBaseID:FBgn0003008 Length:191 Species:Drosophila melanogaster


Alignment Length:158 Identity:56/158 - (35%)
Similarity:94/158 - (59%) Gaps:8/158 - (5%)


- Green bases have known domain annotations that are detailed below.


Human     4 MLLFSRQGKLRLQKWYVPLSDKEKKKITRELVQTVLARKPKMCSFLE------WRDLKIVYKRYA 62
            :|:|:..||.||.|:|....:..:::|.:|..|.|..|...:|:|||      ..|.|::|:.||
  Fly     5 ILVFNNHGKPRLSKFYQYFDESLQQQIIKETFQLVSKRDDNVCNFLEGGSLIGGSDYKLIYRHYA 69

Human    63 SLYFCCAIEDQDNELITLEIIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLLGGEVQETSK 127
            :|||...::..::||..|::|..:||.|||.|.:|||||:||:.:..:.||.|.::||.|.:|:.
  Fly    70 TLYFVFCVDSSESELGILDLIQVFVETLDKCFENVCELDLIFHADAVHHILSELVMGGMVLQTNM 134

Human   128 KNVLKAIEQADLL--QEDAKEAETPRSV 153
            .:::..||:.:.:  ||....|...|:|
  Fly   135 NDIMARIEEQNKIVKQEAGISAAPARAV 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AP1S2NP_001259000.1 AP1_sigma 2..144 CDD:341435 53/147 (36%)
orNP_536793.1 AP3_sigma 1..146 CDD:341438 51/140 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53551
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.