DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CPNE1 and CG8563

DIOPT Version :9

Sequence 1:	NP_003906.2	Gene:	CPNE1 / 8904	HGNCID:	2314	Length:	542	Species:	Homo sapiens
Sequence 2:	NP_001261515.1	Gene:	CG8563 / 38826	FlyBaseID:	FBgn0035777	Length:	440	Species:	Drosophila melanogaster

Alignment Length:	135	Identity:	33/135 - (24%)
Similarity:	44/135 - (32%)	Gaps:	53/135 - (39%)

- Green bases have known domain annotations that are detailed below.

Human   320 EYLMALWSVGSVVQDYDSDKLFPAFGFGAQVPPD-----------WQVS-HEFALNFNPSNPYCA 372
            |.|..|.:...|:||.:. .|.|.      |.||           |:.: |.:|      ...|:
  Fly   221 ELLSNLRAFTRVLQDVEI-FLVPL------VNPDGYEYTHTTDRFWRKNRHRYA------GHSCS 272

Human   373 GIQGIVDAYRQALPQVRLYGPTNFAPIINHVARFAAQAAHQGTASQYFMLLLLTDGAVTDVEATR 437
            |    ||..|            ||.   ||   :..|.|.|...|:.:      .|...:.|...
  Fly   273 G----VDINR------------NFG---NH---WNYQGASQNLCSEVY------SGTAPNSEPET 309

Human   438 EAVVR 442
            .||||
  Fly   310 SAVVR 314

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CPNE1	NP_003906.2	C2A_Copine	11..129	CDD:176013
		C2B_Copine	143..250	CDD:176012
		vWA_copine_like	256..514	CDD:238736	33/135 (24%)
CG8563	NP_001261515.1	M14_CP_A-B_like	146..437	CDD:199844	33/135 (24%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	1	0.950	-	0	Normalized mean entropy	S4063
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.950