powered by:
Protein Alignment CPNE1 and CG8563
DIOPT Version :9
Sequence 1: | NP_003906.2 |
Gene: | CPNE1 / 8904 |
HGNCID: | 2314 |
Length: | 542 |
Species: | Homo sapiens |
Sequence 2: | NP_001261515.1 |
Gene: | CG8563 / 38826 |
FlyBaseID: | FBgn0035777 |
Length: | 440 |
Species: | Drosophila melanogaster |
Alignment Length: | 135 |
Identity: | 33/135 - (24%) |
Similarity: | 44/135 - (32%) |
Gaps: | 53/135 - (39%) |
- Green bases have known domain annotations that are detailed below.
Human 320 EYLMALWSVGSVVQDYDSDKLFPAFGFGAQVPPD-----------WQVS-HEFALNFNPSNPYCA 372
|.|..|.:...|:||.:. .|.|. |.|| |:.: |.:| ...|:
Fly 221 ELLSNLRAFTRVLQDVEI-FLVPL------VNPDGYEYTHTTDRFWRKNRHRYA------GHSCS 272
Human 373 GIQGIVDAYRQALPQVRLYGPTNFAPIINHVARFAAQAAHQGTASQYFMLLLLTDGAVTDVEATR 437
| ||..| ||. || :..|.|.|...|:.: .|...:.|...
Fly 273 G----VDINR------------NFG---NH---WNYQGASQNLCSEVY------SGTAPNSEPET 309
Human 438 EAVVR 442
.||||
Fly 310 SAVVR 314
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
1 |
0.950 |
- |
0 |
Normalized mean entropy |
S4063 |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.950 |
|
Return to query results.
Submit another query.