DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CPNE1 and CG8945

DIOPT Version :9

Sequence 1:NP_003906.2 Gene:CPNE1 / 8904 HGNCID:2314 Length:542 Species:Homo sapiens
Sequence 2:NP_573190.1 Gene:CG8945 / 32693 FlyBaseID:FBgn0030815 Length:1430 Species:Drosophila melanogaster


Alignment Length:212 Identity:40/212 - (18%)
Similarity:67/212 - (31%) Gaps:97/212 - (45%)


- Green bases have known domain annotations that are detailed below.


Human   162 KSDPFLEFFRQGDGKWHLVYRSEVIKNNLNPTWKRFSVPVQHFCGGNPSTPIQVQCSDYDSDG-- 224
            ||:..:||.|                   |.||  :.:||.     ||             ||  
  Fly  1193 KSNEDVEFIR-------------------NTTW--YIMPVL-----NP-------------DGYA 1218

Human   225 -SHDLIGTFHTSLAQLQAVPAEFECIHPEKQQKKKSYKNSGTIRVKICRVETEYSFLDYVMGGCQ 288
             ||:....:..|.:|.|..|.                  ||.:       ::..::|....|..:
  Fly  1219 YSHEYDRFWKKSRSQHQTPPP------------------SGLL-------DSAMTWLQQKRGPDK 1258

Human   289 INFTVGVD-----FTGSNGDPSSPDSLHYLSPT--------GVNEYLM----------ALWSVGS 330
            :.:.|.:|     ..|..|...:|.:..|..|.        .|:|:||          :|.:.|.
  Fly  1259 VCYGVDLDRNWLYHWGKRGSSKAPCNEFYAGPAPFSEPETKAVSEFLMDYRTQIKLYISLQAYGQ 1323

Human   331 VV-------QDYDSDKL 340
            |:       ..::|::|
  Fly  1324 VISYPVKANSTFNSERL 1340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CPNE1NP_003906.2 C2A_Copine 11..129 CDD:176013
C2B_Copine 143..250 CDD:176012 20/90 (22%)
vWA_copine_like 256..514 CDD:238736 20/115 (17%)
CG8945NP_573190.1 Propep_M14 988..1058 CDD:280416
M14_CP_A-B_like 1089..1430 CDD:199844 40/212 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S4063
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.