Sequence 1: | NP_003906.2 | Gene: | CPNE1 / 8904 | HGNCID: | 2314 | Length: | 542 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_573190.1 | Gene: | CG8945 / 32693 | FlyBaseID: | FBgn0030815 | Length: | 1430 | Species: | Drosophila melanogaster |
Alignment Length: | 212 | Identity: | 40/212 - (18%) |
---|---|---|---|
Similarity: | 67/212 - (31%) | Gaps: | 97/212 - (45%) |
- Green bases have known domain annotations that are detailed below.
Human 162 KSDPFLEFFRQGDGKWHLVYRSEVIKNNLNPTWKRFSVPVQHFCGGNPSTPIQVQCSDYDSDG-- 224
Human 225 -SHDLIGTFHTSLAQLQAVPAEFECIHPEKQQKKKSYKNSGTIRVKICRVETEYSFLDYVMGGCQ 288
Human 289 INFTVGVD-----FTGSNGDPSSPDSLHYLSPT--------GVNEYLM----------ALWSVGS 330
Human 331 VV-------QDYDSDKL 340 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CPNE1 | NP_003906.2 | C2A_Copine | 11..129 | CDD:176013 | |
C2B_Copine | 143..250 | CDD:176012 | 20/90 (22%) | ||
vWA_copine_like | 256..514 | CDD:238736 | 20/115 (17%) | ||
CG8945 | NP_573190.1 | Propep_M14 | 988..1058 | CDD:280416 | |
M14_CP_A-B_like | 1089..1430 | CDD:199844 | 40/212 (19%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 1 | 0.950 | - | 0 | Normalized mean entropy | S4063 |
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.950 |