DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CCNA2 and CycB3

DIOPT Version :9

Sequence 1:NP_001228.2 Gene:CCNA2 / 890 HGNCID:1578 Length:432 Species:Homo sapiens
Sequence 2:NP_001262934.1 Gene:CycB3 / 42971 FlyBaseID:FBgn0015625 Length:575 Species:Drosophila melanogaster


Alignment Length:469 Identity:133/469 - (28%)
Similarity:208/469 - (44%) Gaps:105/469 - (22%)


- Green bases have known domain annotations that are detailed below.


Human    15 GSALLALQQTALQEDQ-ENINP-----EKAAPVQQPRTRAALAVLKSGNPRGLAQQQRPKTRRVA 73
            |::.:..:.::..||. ||.:.     |:|....:||.:|..|..|:    .|.:.|.|....  
  Fly   128 GASKMTTRASSKVEDSVENCHKVLDKLEEALARPKPRPKAVPAAKKT----VLGEVQLPAMPN-- 186

Human    74 PLKDLPVNDEHVTVPPWKANSKQPAFTIHVDEAEKEAQKKPAESQKI-----EREDAL---AFNS 130
            |:: :|     |.:||           .|...|.:.|..||.  ::|     :.||:|   |...
  Fly   187 PMQ-IP-----VLLPP-----------THNLAAPQVAAVKPV--RRISNDFNKTEDSLYMSALED 232

Human   131 AISLPGPRKPLVPLDYPMDGSFES-----------------------PHTMDMSIILEDEKPVSV 172
            ..|....|         :.|:||:                       |.|....::.....|..|
  Fly   233 VSSCDSMR---------LSGNFEAARRRSAKLQQKTEQQPQPLLLTLPETAPSQVVPIPPVPEEV 288

Human   173 N-----------EVPDYHEDIHTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYK 226
            .           :|..|..||..||:..|.:. |...||.:|..:|..||.:||||:|||.|.::
  Fly   289 EDFDRKNWDDPFQVSHYAMDIFNYLKVREAEF-PIADYMPRQIHLTTWMRTLLVDWMVEVQETFE 352

Human   227 LQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQV 291
            |.:|||:|||..:|.:|....:.:.||||:|.||..:|.|::|..||.:.:|:||.|..|...::
  Fly   353 LNHETLYLAVKIVDLYLCREVINKEKLQLLGAAAFFIACKYDERQPPLIEDFLYICDGAYNHDEL 417

Human   292 LRMEHLVLKVLTFDLAAPTVNQFLTQYFLHQQPANC-KVE----SLAMFLGELSLIDADPY--LK 349
            :|||...|:|:.:||..|...:||.:|      |.| ||.    :||.::.||||:|   |  :.
  Fly   418 VRMERETLRVIKYDLGIPLSYRFLRRY------ARCAKVPMPTLTLARYILELSLMD---YANIS 473

Human   350 YLPSVIAGAAFHLALYTVTG------QSWPESLIRKTGYTLESLKPCLMDLHQTYLKAPQHAQQS 408
            :..|.:|.||..:||....|      |:|..:||..|||.|......:..|:....:.|:...::
  Fly   474 FSDSQMASAALFMALRMHGGPGQLDKQTWTSTLIYYTGYQLADFAEIVTALNAGLHRKPRATIKT 538

Human   409 IREKYKNSKYHGVS 422
            ||.||.:..:|.|:
  Fly   539 IRNKYSHKIFHEVA 552

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CCNA2NP_001228.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 26..45 6/24 (25%)
Cyclin_N2 28..166 CDD:406812 36/174 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 55..75 3/19 (16%)
CYCLIN_CCNA2_rpt1 175..305 CDD:410264 53/129 (41%)
CYCLIN_CCNA2_rpt2 309..419 CDD:410267 37/122 (30%)
CycB3NP_001262934.1 Cyclin_N 308..433 CDD:278560 52/125 (42%)
Cyclin_C 435..555 CDD:281044 39/127 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D993640at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X94
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.