DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CCNA2 and CycA

DIOPT Version :9

Sequence 1:NP_001228.2 Gene:CCNA2 / 890 HGNCID:1578 Length:432 Species:Homo sapiens
Sequence 2:NP_524030.2 Gene:CycA / 39340 FlyBaseID:FBgn0000404 Length:491 Species:Drosophila melanogaster


Alignment Length:424 Identity:163/424 - (38%)
Similarity:239/424 - (56%) Gaps:59/424 - (13%)


- Green bases have known domain annotations that are detailed below.


Human    47 RAALAVLKSGN----PRGLAQQQRPKTRRVAPLKDLPVNDEHVTVPPWKAN-----SKQPAFTIH 102
            ||..|||...|    |.|..|..|       .:::|.| ||:|.....|:|     .:...|:::
  Fly    46 RANFAVLNGNNNVPRPAGKVQVFR-------DVRNLNV-DENVEYGAKKSNVVPVVEQFKTFSVY 102

Human   103 VDEAEKE-AQKKPAESQKIEREDALAFNSAISLPGPRKPLVPLDYPMDGS------FESPHTMDM 160
            .|..:.: |....:.:..:::|     |..:.....:|.||  ||.:|.:      .:||.::|.
  Fly   103 EDNNDTQVAPSGKSLASLVDKE-----NHDVKFGAGQKELV--DYDLDSTPMSVTDVQSPMSVDR 160

Human   161 SII---------LEDEKPVS----VNEVP------------DYHEDIHTYLREMEVKCKPKVGYM 200
            ||:         :..|..||    |.|:|            .|..||..|.||.|.|.:||..||
  Fly   161 SILGVIQSSDISVGTETGVSPTGRVKELPPRNDRQRFLEVVQYQMDILEYFRESEKKHRPKPLYM 225

Human   201 KKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLAS 265
            ::|.||:::||:||:||||||.|||||..|||:|:|.|:|||||.|:|:|.||||||||||.:|:
  Fly   226 RRQKDISHNMRSILIDWLVEVSEEYKLDTETLYLSVFYLDRFLSQMAVVRSKLQLVGTAAMYIAA 290

Human   266 KFEEIYPPEVAEFVYITDDTYTKKQVLRMEHLVLKVLTFDLAAPTVNQFLTQY-FLHQQPANCKV 329
            |:||||||||.|||::|||:|||.||||||.::||:|:|||..||...|:..| .|...|.  |:
  Fly   291 KYEEIYPPEVGEFVFLTDDSYTKAQVLRMEQVILKILSFDLCTPTAYVFINTYAVLCDMPE--KL 353

Human   330 ESLAMFLGELSLIDADPYLKYLPSVIAGAAFHLALYTVTGQSWPESLIRKTGYTLESLKPCLMDL 394
            :.:.:::.||||::.:.||:||||:::.|:..||.:.:..:.|...|...|.|.||.||..::.|
  Fly   354 KYMTLYISELSLMEGETYLQYLPSLMSSASVALARHILGMEMWTPRLEEITTYKLEDLKTVVLHL 418

Human   395 HQTYLKAPQHAQQSIREKYKNSKYHGVSLLNPPE 428
            ..|:..|.:...|::||||....|..|:::...|
  Fly   419 CHTHKTAKELNTQAMREKYNRDTYKKVAMMESVE 452

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CCNA2NP_001228.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 26..45
Cyclin_N2 28..166 CDD:406812 33/143 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 55..75 5/23 (22%)
CYCLIN_CCNA2_rpt1 175..305 CDD:410264 83/141 (59%)
CYCLIN_CCNA2_rpt2 309..419 CDD:410267 36/110 (33%)
CycANP_524030.2 Cyclin_N 206..332 CDD:278560 83/125 (66%)
Cyclin_C 334..450 CDD:281044 38/117 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 179 1.000 Domainoid score I3542
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H55562
Inparanoid 1 1.050 248 1.000 Inparanoid score I3256
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D520533at33208
OrthoFinder 1 1.000 - - FOG0000121
OrthoInspector 1 1.000 - - otm40748
orthoMCL 1 0.900 - - OOG6_100199
Panther 1 1.100 - - O PTHR10177
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4504
SonicParanoid 1 1.000 - - X94
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1413.860

Return to query results.
Submit another query.