DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PRPF4B and Hipk

DIOPT Version :9

Sequence 1:NP_003904.3 Gene:PRPF4B / 8899 HGNCID:17346 Length:1007 Species:Homo sapiens
Sequence 2:NP_001369036.1 Gene:Hipk / 38070 FlyBaseID:FBgn0035142 Length:1409 Species:Drosophila melanogaster


Alignment Length:530 Identity:147/530 - (27%)
Similarity:236/530 - (44%) Gaps:66/530 - (12%)


- Green bases have known domain annotations that are detailed below.


Human   504 FKGSLSEGMKVEQESSSDDN--LEDFDVEEEDEEALIEQRRIQRQAIVQKYKYLAEDSNMSVPSE 566
            |...|..|:.|...|...|.  ....|.....|:   :|:::|:|   |:...|.:.:..:..|.
  Fly    25 FCSGLGAGLSVRATSFYGDQTVTATTDGTRHQEQ---QQQQLQQQ---QQQHILRQPATSASTSS 83

Human   567 PSSPQSSTRTRSPSPDDILERVAADVKEYERENVDTFEASVKAKHNLMTVEQNNGSSQKKLLAPD 631
            .::..:|.|.|....|      ...|..|...:....:....|.....:|....||..    .||
  Fly    84 VAAAATSKRKRQTDCD------CGCVDSYNSSHGPPVQQDSSAAAGAGSVGSKAGSGP----GPD 138

Human   632 MFTESDDMFAAYFDSARLRAAGIGKDFKENPNLRDNWTDAEGYYRVNIGEV---LDKRYNVYGYT 693
            .......:     .:|..:.|..|......|..:.:.:.|:|.|::...||   |...|.|..:.
  Fly   139 GIGPISSL-----KTAHTKVATSGGHANTQPPSKRSSSGADGDYQLVQHEVLYSLSAEYEVLEFL 198

Human   694 GQGVFSNVVRARDNARANQEVAVKIIRNNELMQKTGLKELEFLKKLNDADPDDKFHCLRLFRHFY 758
            |:|.|..||:..... .::.||:||::|:....:.|..|:..|.:|:..:.|: |:.:|.|..|.
  Fly   199 GRGTFGQVVKCWKRG-TSEIVAIKILKNHPSYARQGQIEVSILSRLSQENADE-FNFVRAFECFQ 261

Human   759 HKQHLCLVFEPLSMNLREVLKKYGKDVGLHIKAVRSYSQQLFLALKLLKRCNILHADIKPDNILV 823
            ||.|.|||||.|..||.:.||: .|...|.:|.:|...:|:..||..||:..::|||:||:||::
  Fly   262 HKNHTCLVFEMLEQNLYDFLKQ-NKFSPLPLKYIRPILEQVLTALLKLKQLGLIHADLKPENIML 325

Human   824 NE---SKTILKLCDFGSASHVADNDITPYLVSRFYRAPEIIIGKSYDYGIDMWSVGCTLYELYTG 885
            .:   ....:|:.||||||||:......||.||:|||||||:|..:...|||||:||.:.||:.|
  Fly   326 VDPVRQPYRVKVIDFGSASHVSKTVCNTYLQSRYYRAPEIILGLPFCEAIDMWSLGCVVAELFLG 390

Human   886 KILFPGKTNNHMLKLAMDLKGKMPNKMIRKGVFKDQHFDQNLNFMYIEVD--------KVTEREK 942
            ..|:||.:....::.....:|.....|:...       .:...|.|.:||        |.||..:
  Fly   391 WPLYPGSSEFDQIRYISQTQGLPTEHMLNSA-------SKTSKFFYRDVDSTYPFWRLKTTEEHE 448

Human   943 VTVMSTINPTKDLL-------------ADLIGCQRLPE--DQRKKVHQLKDLLDQILMLDPAKRI 992
            ....:.....:..:             .||.|.|.|.|  |:|:.:    |||.::|.:|..:|:
  Fly   449 AETNTKSKEARKYIFNCLDDIGQVNVPTDLEGGQLLAEKTDRREFI----DLLKRMLTIDQERRL 509

Human   993 SINQALQHAF 1002
            :..:||.|:|
  Fly   510 TPAEALNHSF 519

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PRPF4BNP_003904.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..99
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 140..533 7/30 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 559..583 4/23 (17%)
STKc_PRP4 686..1003 CDD:271037 111/343 (32%)
S_TKc 694..1003 CDD:214567 109/335 (33%)
HipkNP_001369036.1 STKc_HIPK 192..520 CDD:271113 111/342 (32%)
PHA03378 <1080..1327 CDD:223065
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0667
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.