DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BUD31 and l(1)10Bb

DIOPT Version :9

Sequence 1:XP_005250727.1 Gene:BUD31 / 8896 HGNCID:29629 Length:145 Species:Homo sapiens
Sequence 2:NP_511117.1 Gene:l(1)10Bb / 32069 FlyBaseID:FBgn0001491 Length:144 Species:Drosophila melanogaster


Alignment Length:127 Identity:111/127 - (87%)
Similarity:119/127 - (93%) Gaps:0/127 - (0%)


- Green bases have known domain annotations that are detailed below.


Human     1 MPKVKRSRKAPPDGWELIEPTLDELDQKMREAETEPHEGKRKVESLWPIFRIHHQKTRYIFDLFY 65
            ||||:||||.||||||||||||:||:|||||||||||||||..|||||||:|||||||||:||||
  Fly     1 MPKVRRSRKPPPDGWELIEPTLEELEQKMREAETEPHEGKRITESLWPIFKIHHQKTRYIYDLFY 65

Human    66 KRKAISRELYEYCIKEGYADKNLIAKWKKQGYENLCCLRCIQTRDTNFGTNCICRVPKSKLE 127
            :|||||||||:||:||..||.||||||||.||||||||||||||||||||||||||||.|||
  Fly    66 RRKAISRELYDYCLKEKIADGNLIAKWKKSGYENLCCLRCIQTRDTNFGTNCICRVPKCKLE 127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BUD31XP_005250727.1 G10 1..134 CDD:395894 111/127 (87%)
l(1)10BbNP_511117.1 G10 1..143 CDD:395894 111/127 (87%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165156601
Domainoid 1 1.000 279 1.000 Domainoid score I1709
eggNOG 1 0.900 - - E1_COG5132
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H2906
Inparanoid 1 1.050 281 1.000 Inparanoid score I2901
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54565
OrthoDB 1 1.010 - - D1236198at2759
OrthoFinder 1 1.000 - - FOG0004600
OrthoInspector 1 1.000 - - oto91747
orthoMCL 1 0.900 - - OOG6_102341
Panther 1 1.100 - - LDO PTHR19411
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R272
SonicParanoid 1 1.000 - - X3217
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.