DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ARHGEF7 and PIN3

DIOPT Version :9

Sequence 1:NP_001340975.1 Gene:ARHGEF7 / 8874 HGNCID:15607 Length:862 Species:Homo sapiens
Sequence 2:NP_015480.1 Gene:PIN3 / 856277 SGDID:S000006358 Length:215 Species:Saccharomyces cerevisiae


Alignment Length:104 Identity:31/104 - (29%)
Similarity:43/104 - (41%) Gaps:17/104 - (16%)


- Green bases have known domain annotations that are detailed below.


Human   168 VRAKFNFQQTNEDELSFSKGDVIHVTRVEEGGWWEGTLNGRTGWFPSNYVREVKASEKPV-SPKS 231
            |.|.:.|....:.:|....||.:.:.......|::|:.|||||.||:|||       ||. |..:
Yeast    59 VEALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWYKGSCNGRTGIFPANYV-------KPAFSGSN 116

Human   232 GTLKSPPKGFDTTAINKSYYNVVLQNILETENEYSKELQ 270
            |....||.        ..|....||.| .|:|..:...|
Yeast   117 GPSNLPPP--------PQYKAQELQQI-PTQNSAASSYQ 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ARHGEF7NP_001340975.1 CH 21..107 CDD:237981
RhoGEF67_u1 117..163 CDD:318756
SH3_betaPIX 167..220 CDD:212994 18/51 (35%)
RhoGEF 251..428 CDD:238091 6/20 (30%)
PH_Cool_Pix 459..557 CDD:269932
Atrophin-1 <562..>643 CDD:331285
RhoGEF67_u2 613..711 CDD:318755
betaPIX_CC 773..859 CDD:318676
PIN3NP_015480.1 SH3 58..110 CDD:418401 18/57 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.