DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CCKBR and PK2-R2

DIOPT Version :10

Sequence 1:NP_001350481.1 Gene:CCKBR / 887 HGNCID:1571 Length:516 Species:Homo sapiens
Sequence 2:NP_731788.1 Gene:PK2-R2 / 41638 FlyBaseID:FBgn0038139 Length:599 Species:Drosophila melanogaster


Alignment Length:34 Identity:11/34 - (32%)
Similarity:14/34 - (41%) Gaps:6/34 - (17%)


- Green bases have known domain annotations that are detailed below.


Human   141 ERISNPRINCMPASCKYNLEKTRPSGERQPPQYT 174
            |.|.|..|.      ||||..|....:|:...|:
  Fly    28 EFIQNQTIT------KYNLASTLEFQKRRLSLYS 55

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CCKBRNP_001350481.1 7tm_GPCRs 55..470 CDD:475119 11/34 (32%)
TM helix 1 57..81 CDD:320645
TM helix 2 90..112 CDD:320645
TM helix 3 128..150 CDD:320645 4/8 (50%)
TM helix 4 173..189 CDD:320645 1/2 (50%)
TM helix 5 216..239 CDD:320645
TM helix 6 401..423 CDD:320645
TM helix 7 438..463 CDD:320645
PK2-R2NP_731788.1 7tmA_capaR 69..355 CDD:320262
TM helix 1 69..94 CDD:320262
TM helix 2 101..127 CDD:320262
TM helix 3 140..170 CDD:320262
TM helix 4 182..204 CDD:320262
TM helix 5 225..253 CDD:320262
TM helix 6 275..305 CDD:320262
TM helix 7 323..348 CDD:320262
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.