DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CCKAR and CCKLR-17D3

DIOPT Version :9

Sequence 1:NP_000721.1 Gene:CCKAR / 886 HGNCID:1570 Length:428 Species:Homo sapiens
Sequence 2:NP_001097023.1 Gene:CCKLR-17D3 / 32864 FlyBaseID:FBgn0030954 Length:584 Species:Drosophila melanogaster


Alignment Length:479 Identity:166/479 - (34%)
Similarity:237/479 - (49%) Gaps:71/479 - (14%)


- Green bases have known domain annotations that are detailed below.


Human    15 TPPCELGLENETLFCL---DQPRPS---------KEWQPAVQILLYSLIFLLSVLGNTLVITVLI 67
            |.|.:  |..|..|.|   ..|.||         ....|...|..||:|.|.:||||.|||:.|:
  Fly    75 TEPSD--LVTELAFSLGTSSSPSPSSTPASSSSTSTGMPVWLIPSYSMILLFAVLGNLLVISTLV 137

Human    68 RNKRMRTVTNIFLLSLAVSDLMLCLFCMPFNLIPNLLKDFIFGSAVCKTTTYFMGTSVSVSTFNL 132
            :|:||||:||:|||:||:||::|.:.|||..|:..||::||||..:||...:....||:||::.|
  Fly   138 QNRRMRTITNVFLLNLAISDMLLGVLCMPVTLVGTLLRNFIFGEFLCKLFQFSQAASVAVSSWTL 202

Human   133 VAISLERYGAICKPLQSRVWQTKSHALKVIAATWCLSFTIMTPYPIYSNLVPFTKNNNQTANMCR 197
            ||||.|||.|||.||:||.|||.|||.|:|...|......|||..::|.|:|.::..   ...||
  Fly   203 VAISCERYYAICHPLRSRSWQTISHAYKIIGFIWLGGILCMTPIAVFSQLIPTSRPG---YCKCR 264

Human   198 FLLPNDVMQQSWHTFLLLILFLIPGIVMMVAYGLISLELYQGIKFEASQ-----------KKSAK 251
            ...|:...:..::..|..:|.::|.:|:.|||.||:..||.|:..::.:           .....
  Fly   265 EFWPDQGYELFYNILLDFLLLVLPLLVLCVAYILITRTLYVGMAKDSGRILQQSLPVSATTAGGS 329

Human   252 ERKPSTTSS---------------------GKYEDSDG-------CYLQKTRPPRKLELRQLST- 287
            ...|.|:||                     |..|.|.|       .....|||.....:...:| 
  Fly   330 APNPGTSSSSNCILVLTATAVYNENSNNNNGNSEGSAGGGSTNMATTTLTTRPTAPTVITTTTTT 394

Human   288 -----GSSSRANRI-----RSNSSAANLMAKKRVIRMLIVIVVLFFLCWMPIFSANAWRAYDTAS 342
                 .:||.:.|:     |.::.|..|.:||||::||.|:|:.||:||.|::..|.........
  Fly   395 TVTLAKTSSPSIRVHDAALRRSNEAKTLESKKRVVKMLFVLVLEFFICWTPLYVINTMVMLIGPV 459

Human   343 AERRLSGTPISFILLLSYTSSCVNPIIYCFMNKRFRLGFMATFPCCPNPGPPGARGEVGEEEEGG 407
            ....:..|.|||:.||:|:|||.|||.|||||..||..|:.||...|.....||.|.||....||
  Fly   460 VYEYVDYTAISFLQLLAYSSSCCNPITYCFMNASFRRAFVDTFKGLPWRRGAGASGGVGGAAGGG 524

Human   408 TT----GASLSRFSYSHMSASVPP 427
            .:    ||....::.::.:.|:.|
  Fly   525 LSASQAGAGPGAYASANTNISLNP 548

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CCKARNP_000721.1 CholecysA-Rec_N 1..47 CDD:286302 11/43 (26%)
7tm_4 48..>196 CDD:304433 73/147 (50%)
7tm_1 58..370 CDD:278431 127/361 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 248..272 8/51 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 394..428 11/38 (29%)
CCKLR-17D3NP_001097023.1 7tm_4 120..>244 CDD:304433 65/123 (53%)
7tm_1 128..487 CDD:278431 127/361 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147360
Domainoid 1 1.000 227 1.000 Domainoid score I2509
eggNOG 1 0.900 - - E33208_3BDYY
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 256 1.000 Inparanoid score I3167
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1042780at2759
OrthoFinder 1 1.000 - - FOG0001992
OrthoInspector 1 1.000 - - otm42082
orthoMCL 1 0.900 - - OOG6_105354
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1306
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1211.660

Return to query results.
Submit another query.