DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PROZ and CG11836

DIOPT Version :9

Sequence 1:XP_016876301.1 Gene:PROZ / 8858 HGNCID:9460 Length:467 Species:Homo sapiens
Sequence 2:NP_001356925.1 Gene:CG11836 / 43007 FlyBaseID:FBgn0039272 Length:333 Species:Drosophila melanogaster


Alignment Length:252 Identity:59/252 - (23%)
Similarity:105/252 - (41%) Gaps:28/252 - (11%)


- Green bases have known domain annotations that are detailed below.


Human   230 KQCVPHDQCACGVLTSEKR-----APDLQDLPWQVKLTNSEGKDFCGGVIIRENFVLTTAKCSLL 289
            |.|    .|.||....|.|     ...:...||..::. .:||..|||.::.:::||:.|.|...
  Fly    82 KNC----DCDCGFSNEEIRIVGGKPTGVNQYPWMARIV-YDGKFHCGGSLLTKDYVLSAAHCVKK 141

Human   290 HRNITVKTYFNRTSQD------PLMIKITHVHVHMRYDADAGENDLSLLELEWPIQCPGAGLPVC 348
            .|...::..|....|:      .:...:|.|..|..:|.|...||::||.|..||.......|:|
  Fly   142 LRKSKIRVIFGDHDQEITSESQAIQRAVTAVIKHKSFDPDTYNNDIALLRLRKPISFSKIIKPIC 206

Human   349 TPEKDFAEHLLIPRTR-GLLSGWAR--NGTDLGNSLTTRPVTLVEGEEC--GQVLNVTVTTRTYC 408
            .|..::.     |..| |.:.||.|  .|.:|.:.:....|.::...||  .:..:..:|:...|
  Fly   207 LPRYNYD-----PAGRIGTVVGWGRTSEGGELPSIVNQVKVPIMSITECRNQRYKSTRITSSMLC 266

Human   409 E-RSSVAAMHWMDGSVVTREHRGSWFLTGVLG-SQPVGGQAHMVLVTKVSRYSLWFK 463
            . |.|:.:.....|..:...:...:|:.|::. ....|.:.:..:.::||::..|.|
  Fly   267 AGRPSMDSCQGDSGGPLLLSNGVKYFIVGIVSWGVGCGREGYPGVYSRVSKFIPWIK 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PROZXP_016876301.1 None
CG11836NP_001356925.1 Tryp_SPc 97..325 CDD:238113 52/233 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.