DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CCK and Cck

DIOPT Version :10

Sequence 1:NP_000720.1 Gene:CCK / 885 HGNCID:1569 Length:115 Species:Homo sapiens
Sequence 2:XP_038936801.1 Gene:Cck / 25298 RGDID:2288 Length:141 Species:Rattus norvegicus


Alignment Length:141 Identity:90/141 - (63%)
Similarity:95/141 - (67%) Gaps:26/141 - (18%)


- Green bases have known domain annotations that are detailed below.


Human     1 MNSGVCLCVLMAVLAAGALTQPVPPADPAGSGLQRAEEAPRRQLRVSQRTDGESRAHLGALLARY 65
            |..||||||:|||||||||.|||.|.:......||||||||||||...|.|.|.||.||||||||
  Rat     1 MKCGVCLCVVMAVLAAGALAQPVVPVEAVDPMEQRAEEAPRRQLRAVLRPDSEPRARLGALLARY 65

Human    66 IQQAR--------------------------KAPSGRMSIVKNLQNLDPSHRISDRDYMGWMDFG 104
            |||.|                          ||||||||::||||.|||||||||||||||||||
  Rat    66 IQQVRKGGALYPRKTHPVDSQFPNREGVSLEKAPSGRMSVLKNLQGLDPSHRISDRDYMGWMDFG 130

Human   105 RRSAEEYEYPS 115
            |||||:|||||
  Rat   131 RRSAEDYEYPS 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CCKNP_000720.1 Gastrin 3..115 CDD:459996 87/137 (64%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 23..52 15/28 (54%)
CckXP_038936801.1 Gastrin 4..141 CDD:459996 87/136 (64%)

Return to query results.
Submit another query.