DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CCK and Cck

DIOPT Version :10

Sequence 1:NP_000720.1 Gene:CCK / 885 HGNCID:1569 Length:115 Species:Homo sapiens
Sequence 2:NP_001271437.1 Gene:Cck / 12424 MGIID:88297 Length:134 Species:Mus musculus


Alignment Length:71 Identity:53/71 - (74%)
Similarity:56/71 - (78%) Gaps:0/71 - (0%)


- Green bases have known domain annotations that are detailed below.


Human     1 MNSGVCLCVLMAVLAAGALTQPVPPADPAGSGLQRAEEAPRRQLRVSQRTDGESRAHLGALLARY 65
            |.|||||||:|||||||||.|||.||:......|||:||||||||...|||||.||.||||||||
Mouse     1 MKSGVCLCVVMAVLAAGALAQPVVPAEATDPVEQRAQEAPRRQLRAVLRTDGEPRARLGALLARY 65

Human    66 IQQARK 71
            |||.||
Mouse    66 IQQVRK 71

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CCKNP_000720.1 Gastrin 3..115 CDD:459996 52/69 (75%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 23..52 16/28 (57%)
CckNP_001271437.1 Gastrin 3..>71 CDD:474951 50/67 (75%)

Return to query results.
Submit another query.