DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HCAR3 and AstC-R1

DIOPT Version :9

Sequence 1:NP_006009.2 Gene:HCAR3 / 8843 HGNCID:16824 Length:387 Species:Homo sapiens
Sequence 2:NP_649040.2 Gene:AstC-R1 / 40020 FlyBaseID:FBgn0036790 Length:483 Species:Drosophila melanogaster


Alignment Length:379 Identity:95/379 - (25%)
Similarity:171/379 - (45%) Gaps:51/379 - (13%)


- Green bases have known domain annotations that are detailed below.


Human    16 KNCCVFRDDFIAKVLPPVLGLEFIFGLLGNGLALWIFCFHLKSWKSSRIFLFNLAVADFLLIICL 80
            ::|...|:.|.......:.|...|.||.||.|.:::.....|....:.|::.||||||...:|.:
  Fly    66 QHCIATRNSFADLFTVVLYGFVCIIGLFGNTLVIYVVLRFSKMQTVTNIYILNLAVADECFLIGI 130

Human    81 PFVMDYYVRRSDWKFGDIPCRLVLFMFAMNRQGSIIFLTVVAVDRYFRVVHPHHALNKISNWTAA 145
            ||:: |.:|...|:||:..|:..:...::....|.|||.:::.|||..|.||..:....:...|.
  Fly   131 PFLL-YTMRICSWRFGEFMCKAYMVSTSITSFTSSIFLLIMSADRYIAVCHPISSPRYRTLHIAK 194

Human   146 IISCLLWGITVGLTVHLLKKKLLIQNGTANVCISFSICHTFRWHEA------------MFLLEFF 198
            ::|.:.|..:..|.:.::.....::....   |::| |: ..|.:|            .|.|.|.
  Fly   195 VVSAIAWSTSAVLMLPVILYASTVEQEDG---INYS-CN-IMWPDAYKKHSGTTFILYTFFLGFA 254

Human   199 LPLGIILFCSARIIWSLR----------QRQMDRHAKIKRAITFIMVVAIVFVICFLPSVVVRIH 253
            .||..||.....:|..||          :.:...|.|:.|   .::.|..|:::|:||..:.::.
  Fly   255 TPLCFILSFYYLVIRKLRSVGPKPGTKSKEKRRAHRKVTR---LVLTVISVYILCWLPHWISQVA 316

Human   254 IFWLLHTSGTQNCEVYRSVDLAFFITLSFTYMNSMLDPVVYYFSSPSF-PNFFSTLINRCLQRKI 317
               |:|::..|. ::.|...|.|.:..:..|.||.::|::|.|.|.:| .:||...  .|:.:: 
  Fly   317 ---LIHSNPAQR-DLSRLEILIFLLLGALVYSNSAVNPILYAFLSENFRKSFFKAF--TCMNKQ- 374

Human   318 TGEPDNNRSTSVE---LTGDPNKTRGAPEALIANSGE--PWSPSYLGPTSNNHS 366
                |.|....:|   .|...:|.||..:.|:.::.:  |..|...|   ||:|
  Fly   375 ----DINAQLQLEPSVFTKQGSKKRGGSKRLLTSNPQIPPLLPLNAG---NNNS 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HCAR3NP_006009.2 7tm_1 44..294 CDD:278431 67/271 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 319..343 7/26 (27%)
AstC-R1NP_649040.2 7tm_4 88..368 CDD:304433 76/292 (26%)
7tm_1 94..353 CDD:278431 67/271 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.