DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CFLAR and Strica

DIOPT Version :9

Sequence 1:NP_001120655.1 Gene:CFLAR / 8837 HGNCID:1876 Length:480 Species:Homo sapiens
Sequence 2:NP_001260718.1 Gene:Strica / 35528 FlyBaseID:FBgn0033051 Length:527 Species:Drosophila melanogaster


Alignment Length:346 Identity:61/346 - (17%)
Similarity:104/346 - (30%) Gaps:135/346 - (39%)


- Green bases have known domain annotations that are detailed below.


Human   165 KTKIQKYKQSVQGAGTSYRNVLQAAIQKSLKDPSNNFRLHNGRSKEQRLKEQLGAQQEPVKKSIQ 229
            |.|:....||....||         |..||           |.||....|.:|    :|.:..|.
  Fly   278 KPKVTAVAQSQDAQGT---------ISTSL-----------GISKSSLTKNKL----KPARVYIF 318

Human   230 ESEAFLPQSIPEERYKMKSKPLGICLIIDCIGNETELLRDTFTSLGYEVQKFLHLSMHGISQILG 294
            ..|.|      :.:.:.:...          ..:.::||.||..|..:|:.....::..|.:.:.
  Fly   319 NHERF------DNKNEFRKGS----------AQDVKVLRATFEQLKCKVEVITDATLVTIKKTVR 367

Human   295 QFACMPEHRDYD---SFVCVLVSRG-GSQSVYGVDQTHSGLPLHHIRRMFMGDSCPY-------L 348
                |.:.:|::   :.|.|::|.| ....:...|..:|           :.|...:       |
  Fly   368 ----MLQTKDFEDKSALVLVILSHGTRHDQIAAKDDDYS-----------LDDDVVFPILRNRTL 417

Human   349 AGKPKMFFIQNYVVSEGQLEDSSLLEVDGPAMKNVEFKAQKRGLCTVHREADFFWSLCTADMSL- 412
            ..|||:.|:|                                              .|..|..| 
  Fly   418 KDKPKLIFVQ----------------------------------------------ACKGDCQLG 436

Human   413 -----LEQSHSSPSLYLQCLSQ-----KLRQERKRPLLDLHIE-LN--GYMYDWNS--------- 455
                 ..|.:.||:..|:|.|.     ..|.|...|.:....| ||  |...|.::         
  Fly   437 GFMTDAAQPNGSPNEILKCYSTYEGFVSFRTEDGTPFIQTLCEALNRSGKTSDIDTIMMNVRQVV 501

Human   456 RVSAKEKYYVWLQHTLRKKLI 476
            ::.:|::....:..||..|.:
  Fly   502 KMQSKDRQIPSVTSTLTSKYV 522

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CFLARNP_001120655.1 Not proteolytically processed and involved in apoptosis inhibition 1..435 50/291 (17%)
Interaction with CASP8 propeptide. /evidence=ECO:0000269|PubMed:9208847, ECO:0000269|PubMed:9326610 1..305 26/139 (19%)
Interaction with FADD. /evidence=ECO:0000269|PubMed:9208847, ECO:0000269|PubMed:9326610 1..227 15/61 (25%)
Interaction with CASP8. /evidence=ECO:0000269|PubMed:9208847, ECO:0000269|PubMed:9326610 1..195 8/29 (28%)
DED_c-FLIP_r1 1..80 CDD:260044
DED_c-FLIP_r2 91..171 CDD:260046 2/5 (40%)
Interaction with TRAF1 and TRAF2. /evidence=ECO:0000269|PubMed:9208847 192..480 54/319 (17%)
Interaction with CASP3. /evidence=ECO:0000269|PubMed:9208847, ECO:0000269|PubMed:9326610 192..435 43/264 (16%)
Interaction with CASP8 subunits p18 and p10. /evidence=ECO:0000269|PubMed:9208847, ECO:0000269|PubMed:9326610 217..480 48/294 (16%)
CASc 244..479 CDD:214521 43/267 (16%)
Caspase 263..358 21/105 (20%)
Interaction with CASP8. /evidence=ECO:0000269|PubMed:9208847, ECO:0000269|PubMed:9326610 370..480 21/130 (16%)
StricaNP_001260718.1 CASc 311..523 CDD:294037 47/289 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3573
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.