DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SOCS2 and Socs16D

DIOPT Version :9

Sequence 1:XP_016875636.1 Gene:SOCS2 / 8835 HGNCID:19382 Length:243 Species:Homo sapiens
Sequence 2:NP_001259662.1 Gene:Socs16D / 32760 FlyBaseID:FBgn0030869 Length:1021 Species:Drosophila melanogaster


Alignment Length:191 Identity:57/191 - (29%)
Similarity:93/191 - (48%) Gaps:22/191 - (11%)


- Green bases have known domain annotations that are detailed below.


Human    31 PQAARLAKALRELGQTGWYWGSMTVNEAKEKLKEAPEGTFLIRDSSHSDYLLTISVKTSAGPTNL 95
            |:|.:...::.::...|||||.::...|::.|...|:|:|::||||...|:.::|.|.:....::
  Fly   833 PRALQFTSSIEKVKDYGWYWGPLSSEAAEKVLSSEPDGSFIVRDSSDDHYIFSLSFKLNNCVRHV 897

Human    96 RIEYQDGKFRLDSIICVKSKLKQFDSVVHLIDYYVQMCKDKRTG------PEAPRNGTVHLYLTK 154
            |||...|.|...|....||:     ::...|:..|:   ..|:|      ...|.:|.:.:.||.
  Fly   898 RIEQDQGTFSFGSYAKFKSQ-----TITEFIEKAVE---HSRSGRYLFFLHRRPEHGPMRVQLTN 954

Human   155 PL--YTSAPSLQHLCRLTINKCT---GAIWGLPLPTRLKDYLEE---YKFQVQAPVGEKEL 207
            |:  :....||||:||..|.|..   ..|..||||.||.|||..   |..||::.....::
  Fly   955 PVSRFKHVQSLQHMCRFVILKAVIRKDLIQTLPLPRRLLDYLNYKHCYSEQVESDSSHSQI 1015

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SOCS2XP_016875636.1 None
Socs16DNP_001259662.1 SH2_SOCS7 839..937 CDD:198251 29/105 (28%)
SOCS_SOCS7 960..1009 CDD:239710 21/48 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4566
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
32.770

Return to query results.
Submit another query.