DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CES2 and Nlg3

DIOPT Version :9

Sequence 1:NP_001352334.1 Gene:CES2 / 8824 HGNCID:1864 Length:559 Species:Homo sapiens
Sequence 2:NP_001036685.2 Gene:Nlg3 / 40912 FlyBaseID:FBgn0083963 Length:1159 Species:Drosophila melanogaster


Alignment Length:658 Identity:178/658 - (27%)
Similarity:281/658 - (42%) Gaps:145/658 - (22%)


- Green bases have known domain annotations that are detailed below.


Human    30 ASPIRTTHTGQVLGSLVHVKGANAG-VQTFLGIPFAKPPLGPLRFAPPEPPESWSGVRDGTTHPA 93
            :|.|..|..|.:.|.:|.:.|.:.. |:.:.|||:|.||:|.|||.||.....||||:.......
  Fly   154 SSRIINTRNGAISGVIVQLDGRHLDPVEAYRGIPYASPPVGNLRFMPPVSAAMWSGVKKADRFSP 218

Human    94 MCLQDLTAVESEF----------LSQFNMTFP-SDSMSEDCLYLSIYTP------------AHSH 135
            :|.|.|..:.:|.          |.......| ..:.|||||||:||.|            :.|.
  Fly   219 VCPQRLPDIHNETAALERMPKGRLEYLKRLLPYLQNQSEDCLYLNIYVPIQVGSRDSSGSSSSSS 283

Human   136 EGSN----------------------------LPVMVWIHGGALVFGMASLYDGSMLAALENVVV 172
            .||:                            .||:|::||.:..:...:.||||:||:...::|
  Fly   284 AGSSSSGSGGSSSSSSSSSTSSSSAGSGSPAKYPVLVFVHGESYEWNSGNPYDGSVLASYGQILV 348

Human   173 VIIQYRLGVLGFFSTG-DKHA--TGNWGYLDQVAALRWVQQNIAHFGGNPDRVTIFGESAGGTSV 234
            |.|.||||||||.:.. |:::  ..|:|.:|.:|||.|:::|||.|||:|:.:|:.|...|...|
  Fly   349 VTINYRLGVLGFLNANTDRYSKLPANYGLMDIIAALHWLKENIAAFGGDPNSITLAGHGTGAACV 413

Human   235 SSLVVS-PISQG-LFHGAIMESGVALLP-GLIASSADVISTVVANLSACDQVDSEALVGCLRGKS 296
            ..|:.| .:.:| ||:.||:.||..|.| .|:::.|...:.|..:::....:....|:.|||.|:
  Fly   414 HFLISSMAVPEGLLFNRAILMSGSGLAPWSLVSNPAKYAAIVAHHVNCASDLPHAHLMKCLREKT 478

Human   297 KEEILAINKPFK----------MIPGVV--DGVFLPRHPQELLASADFQPVPSIVGVNNNEF--- 346
            .:::|::  |.:          .|.|||  .|.::|..|....|.|..|...:.......|.   
  Fly   479 LDQLLSV--PIRPPEFGFAFGPSIDGVVIDGGDYVPPAPGSPAAQAQAQASTAAGNGLGGEAGIA 541

Human   347 ---GWLIP---------------KVMRIYDTQK--------------------EMDREAS--QAA 371
               ||..|               |:.| ||...                    |.||.:.  :|.
  Fly   542 AAGGWGTPGQLENIVLMRKTAINKLSR-YDLMAGVTRAEAFFSFNSGDVQYGIEADRRSRILKAY 605

Human   372 LQKMLTLLMLPPTFGDLLRE--EYIGDNGDPQTLQAQFQEMMADSMFVIPALQVAHF-QCSRAPV 433
            ::...| ..|...|..::.|  ::......|..::.:..|.::|:..|.||.|.... .......
  Fly   606 VRNTYT-FHLNEIFATIVNEYTDWERPVQHPINIRDETLEALSDAQVVAPAAQTVDLHSADHRNS 669

Human   434 YFYEFQHQPSWLKNIRPPHMKADHGDELPFVFRSFFGGNYIKF----TEEEEQLSRKMMKYWANF 494
            |.|.|.:|..:  ...|......||::||::|.:...|.:..|    |:.|..||..:|.||:||
  Fly   670 YLYVFDYQTRF--GDYPQRQGCIHGEDLPYIFGAPLVGGFNHFTRNYTKTEISLSEVVMFYWSNF 732

Human   495 ARNGNPNGE-GLPH-------------WPLFDQ-EEQYLQLNLQPAVGRALKAHRLQFWKKALPQ 544
            .|.||||.: ...|             |..::. .::||..:.:|.:....:||||.||...:| 
  Fly   733 VRTGNPNEQMETEHGSRQERSRYKTIEWTAYESVHKKYLNFDTKPKLKNHYRAHRLSFWLNLIP- 796

Human   545 KIQELEEP 552
               :|.:|
  Fly   797 ---DLHKP 801

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CES2NP_001352334.1 COesterase 30..538 CDD:306613 173/642 (27%)
Prevents secretion from ER. /evidence=ECO:0000255 556..559
Nlg3NP_001036685.2 COesterase 151..791 CDD:278561 173/642 (27%)
Aes <313..>410 CDD:223730 39/96 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165142568
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1516
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.