DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CES2 and alpha-Est2

DIOPT Version :9

Sequence 1:NP_001352334.1 Gene:CES2 / 8824 HGNCID:1864 Length:559 Species:Homo sapiens
Sequence 2:NP_001262345.1 Gene:alpha-Est2 / 40908 FlyBaseID:FBgn0015570 Length:566 Species:Drosophila melanogaster


Alignment Length:553 Identity:165/553 - (29%)
Similarity:234/553 - (42%) Gaps:112/553 - (20%)


- Green bases have known domain annotations that are detailed below.


Human    33 IRTTHT-------GQVLGSLVHVKGANAGVQTFLGIPFAKPPLGPLRFAPPEPPESWSGVRDGTT 90
            :.|.||       |||.|..............|.|||:||||:|.|||..|:|||.|.||.:.||
  Fly    27 LSTGHTVILDTKYGQVRGLQRKTVYDKEPYFAFEGIPYAKPPVGDLRFRAPQPPEPWQGVLNCTT 91

Human    91 HPAMCLQDLTAVESEFLSQFNMTFPSDSMSEDCLYLSIYTPAHSHEGSNLPVMVWIHGGALVFGM 155
            :.:..:|.            ||.......|||||:|::|..|...| ..|||:|||:||....|.
  Fly    92 NRSKPMQR------------NMLLGIVEGSEDCLHLNVYVKALKSE-KPLPVIVWIYGGGFQKGE 143

Human   156 AS--LYDGSMLAALENVVVVIIQYRLGVLGFFSTGDK--HATGNWGYLDQVAALRWVQQNIAHFG 216
            ||  :|....... :.||.|.|.|||..|||.|..|.  ...||.|..|||.||||:.||||||.
  Fly   144 ASRDIYSPDYFMK-KPVVFVAINYRLAALGFLSLKDPKLDVPGNAGLKDQVMALRWISQNIAHFN 207

Human   217 GNPDRVTIFGESAGGTSVSSLVVSPISQGLFHGAIMESGVALLPGLIASSADVISTVVANLS-AC 280
            |:|:.:|:.|||||..||..::.:..::||||.|||:||.||...:.:...:....:..||. ..
  Fly   208 GDPNNITLMGESAGSASVHVMMTTEQTRGLFHKAIMQSGCALSEWVESPDNNWAFRLAQNLGYKG 272

Human   281 DQVDSEALVGCLRGKSKEEILAIN---------KPFKMI-------PGVVDGVFLPRHPQELLAS 329
            |:.|::.| ..|......:|.||:         :.|.:.       |...|...:|:..::||:.
  Fly   273 DEKDADVL-SFLSKVCARQIAAIDQDVINLDEVRSFLLFAFGPVIEPYETDHCVVPKRHKDLLSE 336

Human   330 ADFQPVPSIVGVNNNE--FGW-LIPK----VMRIYDTQKEMDREASQAALQKMLTLLMLPPTFGD 387
            |....:|.|||.|:.|  |.: |:.|    :...::......||.|....|.:|.          
  Fly   337 AWGNDIPVIVGGNSFEGLFSYQLVRKDPWALKNFHNILPREVRETSSLEGQDLLV---------- 391

Human   388 LLREEYIGDNGDPQTLQAQFQEMMADSMFVIPALQV-AHFQ---------------CSRAPVYFY 436
                        .:..|..|...|.:||.:..||.: :|.|               ..:.|.|.|
  Fly   392 ------------RRLKQLYFNNEMQESMEMFEALNIFSHRQIWHDTHRFILARQSYAPKTPTYLY 444

Human   437 EFQHQPSWLKNIRPPHMK-------------ADHGDELPFVFRSFFGGNYIKFTEEEEQLSRKMM 488
            .|        :...||..             ..|.|||.::|.:.......|.:.|.:.:.| |:
  Fly   445 RF--------DFDSPHFNQFRRLVCGDRIRGVAHADELSYLFYNIIASKLDKSSMEYKTIER-MV 500

Human   489 KYWANFARNGNPNGE--GLPHWPLFDQEEQYLQ 519
            ..|.:||.:||||..  |...|.....:|..::
  Fly   501 GMWTSFASSGNPNCPELGSAKWEAVQLKENAVE 533

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CES2NP_001352334.1 COesterase 30..538 CDD:306613 165/553 (30%)
Prevents secretion from ER. /evidence=ECO:0000255 556..559
alpha-Est2NP_001262345.1 COesterase 32..523 CDD:278561 161/536 (30%)
Aes <117..>221 CDD:223730 49/105 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165142688
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1516
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 216 1.000 Inparanoid score I3612
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000017
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100080
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.690

Return to query results.
Submit another query.