DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DCAF5 and prw1

DIOPT Version :9

Sequence 1:XP_006720360.1 Gene:DCAF5 / 8816 HGNCID:20224 Length:977 Species:Homo sapiens
Sequence 2:NP_594864.1 Gene:prw1 / 2541804 PomBaseID:SPAC29A4.18 Length:431 Species:Schizosaccharomyces pombe


Alignment Length:207 Identity:45/207 - (21%)
Similarity:84/207 - (40%) Gaps:30/207 - (14%)


- Green bases have known domain annotations that are detailed below.


Human    69 LVSGGDDRRVLLWHM---EQAIHSRVKPIQLKGEHHSNIFCLAFNSGNTKVF-SGGNDEQVILHD 129
            ||||..|..:..|.:   .::..:.|..:.: ..|...:..:.|:..:..:. |...|:.:.:||
pombe   200 LVSGSQDATLSCWDLNAYNESDSASVLKVHI-SSHEKQVSDVRFHYKHQDLLASVSYDQYLHVHD 263

Human   130 V-----ESSETLDVFAHEDAVYGLSVSPVNDNIFASSSDDGRVLIWDIR---ESPHGEPFCLANY 186
            :     .:.....|.||...::.::.:|.||.|.|:.|.|..:.:||:|   :..|    .|..:
pombe   264 IRRPDASTKPARSVHAHSGPIHSVAFNPHNDFILATCSTDKTIALWDLRNLNQRLH----TLEGH 324

Human   187 PSAFHSVMFNPVEPRLLATANSKEGVGLWDIRK-------------PQSSLLRYGGNLSLQSAMS 238
            ......:.|:|.|..:||:.::.....:||:.:             |...|..:||:.|....|.
pombe   325 EDIVTKISFSPHEEPILASTSADRRTLVWDLSRIGEDQPAEEAQDGPPELLFMHGGHTSCTIDMD 389

Human   239 VRFNSNGTQLLA 250
            ...|.|.|...|
pombe   390 WCPNYNWTMATA 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DCAF5XP_006720360.1 WD40 16..>396 CDD:225201 45/207 (22%)
WD40 49..396 CDD:295369 45/207 (22%)
WD40 repeat 57..98 CDD:293791 7/31 (23%)
WD40 repeat 104..139 CDD:293791 5/40 (13%)
WD40 repeat 146..187 CDD:293791 12/43 (28%)
WD40 repeat 191..228 CDD:293791 9/49 (18%)
WD40 repeat 280..358 CDD:293791
WD40 repeat 371..395 CDD:293791
prw1NP_594864.1 CAF1C_H4-bd 28..96 CDD:289068
WD40 99..>410 CDD:225201 45/207 (22%)
WD40 110..410 CDD:295369 45/207 (22%)
WD40 repeat 133..182 CDD:293791
WD40 repeat 187..231 CDD:293791 7/31 (23%)
WD40 repeat 238..276 CDD:293791 5/37 (14%)
WD40 repeat 284..322 CDD:293791 11/41 (27%)
WD40 repeat 328..379 CDD:293791 9/50 (18%)
WD40 repeat 384..410 CDD:293791 5/18 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.