DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment IL1RL2 and Dscam2

DIOPT Version :9

Sequence 1:XP_011510393.1 Gene:IL1RL2 / 8808 HGNCID:5999 Length:622 Species:Homo sapiens
Sequence 2:NP_001261500.1 Gene:Dscam2 / 38788 FlyBaseID:FBgn0265296 Length:2101 Species:Drosophila melanogaster


Alignment Length:697 Identity:135/697 - (19%)
Similarity:219/697 - (31%) Gaps:233/697 - (33%)


- Green bases have known domain annotations that are detailed below.


Human    73 PPIT--SGEV-------------SVTWYKNSSKIPVSKIIQSRIHQDETWILFLPMEWGDSGVYQ 122
            |.:|  |||.             .:.|.:...::|..  |:.|:..|.:..:....:..|||||.
  Fly   527 PKVTAVSGETLNLKCPVAGYPIEEIHWERGGRELPDD--IRQRVQPDGSLTISPVQKNSDSGVYT 589

Human   123 CVIKGRDSCH--RIHVNLTVFEKHWCDTSIGGLPNLSDEYKQILHLGKDD--SLTCHLHFPKSCV 183
            |..:.:.. |  |....:||...          |.||.....||.|...|  ||||      |.|
  Fly   590 CWARNKQG-HSARRSGEVTVIV
P----------PKLSPFQTNILQLNMGDRASLTC------SVV 637

Human   184 LG----PIKWYKDCNEIKGERFTVLE------TRLLVSNVSAEDRGNYAC------------QAI 226
            .|    .|.|.||...|...:...::      :.|::.|:.::..|||:|            ||:
  Fly   638 KGDLPLTINWRKDGRPIDPTQHMSVKQVDQYNSILVIENLGSDHTGNYSCVVRNSAAEVENSQAL 702

Human   227 LTH-------------------------------------------SGKQYEV------------ 236
            |.:                                           ||:..||            
  Fly   703 LVNVPPRWIVEPVDANVERNRHIMLHCQAQGVPTPSIVWKKATGSKSGEYEEVRERPFTKLLGNG 767

Human   237 ----------LNGITVSIKRAGYGGSVPKIIYPK----------NHSIEVQLGTTLIVDCNVTDT 281
                      ..|..:.....|.|..:.|:|..|          :.|:.|:.|.|.::.|.|:..
  Fly   768 SLLLQHVKEDREGFYLCQANNGIGTGIGKVIQLKVNSSPYFSSTSRSVMVKKGDTALLQCAVSGD 832

Human   282 KDNTNLRCWRVNNTL--VDDYYDESKR--IREGVETHVSFREHNLYTVNITFLEVKMEDYGLPFM 342
            |....:......|||  ..:|....|:  ..:||...:..|     ||:.|       |.| |:.
  Fly   833 KPINIVWMRSGKNTLNPSTNYKISVKQEATPDGVSAELQIR-----TVDAT-------DSG-PYF 884

Human   343 CHA----GVSTAYIILQ-----LPAPDFRAYLIGGLIALVAVAVSVVYIYNIFKIDIVLWYRSAF 398
            |.|    |.....:.||     ||.....|.:|......:......:...::.|  .::.:|.|.
  Fly   885 CRASNLYGNDQQLVQLQVQEPPLPPSVLEAAMISSRSVNIKWQPKTLGTGDVTK--YIVEFREAD 947

Human   399 HSTETIVDGKLYDAYVLYPKPHKESQRHAVDALVLNILPE-------VLERQCG-----YKLFIF 451
            ||....:....:....:...||       .:|::.|:.|.       :.|...|     .:|.:.
  Fly   948 HSLPPALFVDQWQQIEVKDPPH-------FNAMIENLKPATRYAFRVIAEGSAGRSAPSQELIVR 1005

Human   452 GRDEFPGQAVANVIDENVKLCRRLIVIVVP-------ESLGFGLLKNLSEEQIAVY--SALIQDG 507
            ...:.|.....::....:.....||..|.|       :..|:.:...||......|  :::..||
  Fly  1006 TEPQRPAGPPLSLSARPLSSTELLISWVAPLPELRHGDIQGYNVGYKLSSSGNTAYNFTSVSGDG 1070

Human   508 ----MKVILIELEKIEDYTVMPESIQYIKQKHGAIRWHGDFTE--QSQCMKTKFWKTVRYHMPPR 566
                .:::|..|.|...|||:.::...:..        |..:|  .:|.|:         .:|.|
  Fly  1071 DGGNGELLLSGLAKFARYTVVVQAFNQVGP--------GPLSEPTAAQTME---------DVPSR 1118

Human   567 -----RCRPFPPVQL---LQHTPCYRTAGERVGGHEVCHALMEGLSL 605
                 ||.......|   .|..|.|.|.|           |::|..|
  Fly  1119 PPEDVRCAALSSQSLQVSWQPPPIYHTNG-----------LLQGYKL 1154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IL1RL2XP_011510393.1 Ig 54..140 CDD:299845 18/83 (22%)
Ig2_IL1R_like 158..245 CDD:143234 30/175 (17%)
IG_like 171..229 CDD:214653 21/79 (27%)
TIR 413..563 CDD:279864 29/176 (16%)
Dscam2NP_001261500.1 Ig 51..127 CDD:299845
Ig 138..>203 CDD:299845
I-set 238..327 CDD:254352
Ig 247..327 CDD:299845
I-set 332..418 CDD:254352
IGc2 344..407 CDD:197706
IG_like 432..517 CDD:214653
IGc2 436..507 CDD:197706
I-set 521..610 CDD:254352 20/85 (24%)
IGc2 533..597 CDD:197706 14/65 (22%)
Ig 630..699 CDD:143165 18/74 (24%)
IG_like 714..802 CDD:214653 9/87 (10%)
Ig 725..802 CDD:299845 9/76 (12%)
Ig 823..894 CDD:143165 20/83 (24%)
FN3 906..1006 CDD:238020 17/108 (16%)
FN3 1013..1111 CDD:238020 18/105 (17%)
FN3 1119..1209 CDD:238020 11/47 (23%)
FN3 1219..1313 CDD:238020
Ig 1336..1402 CDD:143165
FN3 1409..1498 CDD:238020
FN3 1515..1588 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.