DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PEX11A and Pex11c

DIOPT Version :10

Sequence 1:NP_003838.1 Gene:PEX11A / 8800 HGNCID:8852 Length:247 Species:Homo sapiens
Sequence 2:NP_001247263.1 Gene:Pex11c / 42751 FlyBaseID:FBgn0039068 Length:234 Species:Drosophila melanogaster


Alignment Length:142 Identity:29/142 - (20%)
Similarity:60/142 - (42%) Gaps:8/142 - (5%)


- Green bases have known domain annotations that are detailed below.


Human    16 RLFRATQYTCMLLRYLLEPKAG-----KEKVVMKLKKLESSVSTGRKWFRLGNVVHAIQ-ATEQS 74
            |:.|..:.....|.|..:..||     ..::..:.....|.:|..|...||.:.:..|| |.|..
  Fly    17 RIIRYERKVMKALCYSAKLVAGYHAKRNPELAKRYATASSRISGARATLRLIDDIPMIQYALEYG 81

Human    75 I--HATDLVPRLCLTLANLNRVIYFICDTILWVRSVGLTSGINKEKWRTRAAHHYYYSLLLSLVR 137
            :  :..|.|.::....||:..::|:..:.:.|:....:....|.:.|....:..:..|:.|:|:|
  Fly    82 LGENEPDRVMQVLGVTANIVDLLYYPIEKVCWLAEHKIVDVKNADNWDNVNSIFWVLSVYLNLMR 146

Human   138 DLYEISLQMKRV 149
            .:...||..:::
  Fly   147 TMRNFSLNQEKL 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PEX11ANP_003838.1 PEX11 1..237 CDD:398979 29/142 (20%)
Required for homodimerization, interaction with PEX11G, and peroxisomal localization. /evidence=ECO:0000269|PubMed:20826455 220..239
Pex11cNP_001247263.1 PEX11 24..226 CDD:398979 27/135 (20%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.