DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DLK1 and NimA

DIOPT Version :9

Sequence 1:NP_003827.4 Gene:DLK1 / 8788 HGNCID:2907 Length:383 Species:Homo sapiens
Sequence 2:NP_001285918.1 Gene:NimA / 318930 FlyBaseID:FBgn0261514 Length:565 Species:Drosophila melanogaster


Alignment Length:472 Identity:103/472 - (21%)
Similarity:150/472 - (31%) Gaps:179/472 - (37%)


- Green bases have known domain annotations that are detailed below.


Human     5 EALLRVLLLLLAFGHSTYGAECFPACNPQNGFCE-DDNVCRCQ------PGWQGPLCDQCV---- 58
            |.|...||||||.        ..|..:.||...: :.||...:      |..||| .:.|:    
  Fly     4 EKLFGKLLLLLAM--------VLPLGSGQNSTLKINTNVKDIEAGVVALPSIQGP-GNICIREEP 59

Human    59 ----------------TSPGCLHGLCGEPGQC-----------------------ICTDGWDGEL 84
                            ||..|:.    .|.:|                       .|..|::|.|
  Fly    60 YVEHVQVPEMQPVRVRTSSWCME----IPPRCATFKTEMREVMRVQKLNKTRTVRFCCQGYEGNL 120

Human    85 CDRDVRACSSAPC-------ANNRTCVSLDDGLYECSCAPGYSGKDC-QKKD----GPCVINGSP 137
            .|      |.|.|       ....:||..|    .|||..||.||.| |:.|    |....|...
  Fly   121 SD------SQATCKPICRGGCGRGSCVMPD----ICSCEEGYIGKHCTQRCDHDRWGLDCKNLCQ 175

Human   138 CQHGGTCVDDEGRASHASCLCPPGFSGNFCEIVANSCTPNPCENDGVCTDIGGDFRCRCPAGFID 202
            ||:|..|.:..|     .|.|..|::|.|||:                         .||.|...
  Fly   176 CQNGAACDNKSG-----LCHCIAGWTGQFCEL-------------------------PCPQGTYG 210

Human   203 KTCSRPVTNCASSPCQ-NGGTCLQHTQ-----VSYECLCKPEFTGLTCVKKRALSPQQVTRLP-- 259
            ..| |...:|...||. ..|.|:|..|     ||:..:   |....| ::|..:.|:..|.:|  
  Fly   211 IMC-RKACDCDEKPCNPQTGACIQQDQPLQLNVSHVIV---ETVNST-LEKMGIIPRPTTPVPLP 270

Human   260 ------------------------SGYGLAYRL---------TPGV-HELP--VQQPEHRILKVS 288
                                    |...|...|         ||.| |.:.  :..|:..:....
  Fly   271 EVIVIKQPTSNENAQHSPKIIVHQSSSDLLENLHTAAAAGVPTPEVIHVITNGITSPQEHLAGFV 335

Human   289 MKELNKKTPLLTEGQA-ICFTILGVLTSLVVLGTVGIVFLNKCETWVSNLRYNHMLRKKKNLLLQ 352
            ..|.|.......:.|: :..|::.::..|:|...||.:::.:        ||:|     ||..: 
  Fly   336 GGEANSSQTATADHQSGLVVTLVSIMLLLLVAIAVGSLYVYR--------RYHH-----KNAAV- 386

Human   353 YNSGEDLAVNIIFPEKI 369
            ||:...:......||.:
  Fly   387 YNANGTVTTLPANPEVV 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DLK1NP_003827.4 EGF_CA 88..125 CDD:238011 14/44 (32%)
EGF_CA 135..168 CDD:238011 10/32 (31%)
EGF_CA 175..205 CDD:238011 3/29 (10%)
EGF_CA 212..245 CDD:238011 11/38 (29%)
NimANP_001285918.1 EMI 52..116 CDD:284877 7/67 (10%)
EGF_2 170..200 CDD:285248 10/34 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143854
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR24052
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.