DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DLK1 and dlk1

DIOPT Version :9

Sequence 1:NP_003827.4 Gene:DLK1 / 8788 HGNCID:2907 Length:383 Species:Homo sapiens
Sequence 2:XP_002936624.1 Gene:dlk1 / 100494606 XenbaseID:XB-GENE-988620 Length:382 Species:Xenopus tropicalis


Alignment Length:373 Identity:178/373 - (47%)
Similarity:231/373 - (61%) Gaps:17/373 - (4%)


- Green bases have known domain annotations that are detailed below.


Human     1 MTATEALLRVLLLLLAFGHSTYGAECFPACNPQNGFCEDDNVCRCQPGWQGPLCDQCVTSPGCLH 65
            |..|.:.:..|.|.......|....|.|.|:|.|||||....|||:.||:|..||||:..|.|:|
 Frog    11 MELTASCILCLFLSRFITTETKEIACMPGCHPVNGFCESQGECRCRTGWKGQFCDQCIPFPACMH 75

Human    66 GLCGEPGQCICTDGWDGELCDRDVRACSSAPCANNRTCVSLDDGLYECSCAPGYSGKDCQKKDGP 130
            |.|.:|.||||.:||.|.|||.||..|::.||::|.||:...||.|.|.|:.||:||:|..|.||
 Frog    76 GSCTKPWQCICEEGWVGSLCDIDVHPCAAKPCSSNSTCIETGDGGYICLCSLGYTGKNCLLKKGP 140

Human   131 CVINGSPCQHGGTCVDDEGRASHASCLCPPGFSGNFCEIV--ANSCTPNPCENDGVCTDIGGDFR 193
            |..||||||:||.|.|:.|.||:|||.|||||.||:|||.  .:.|.||||.|.|.|||||..|.
 Frog   141 CSTNGSPCQNGGKCTDNNGFASYASCQCPPGFIGNYCEIQIDIDDCNPNPCRNGGSCTDIGSGFH 205

Human   194 CRCPAGFIDKTCSRPVTNCASSPCQNGGTCLQHTQVSYECLCKPEFTGLTC-VKKRALSPQQVTR 257
            |.||.||..:.|:.....|:|:||.|||||.|..: .::|.|:|::||.|| ...|.:|.....|
 Frog   206 CHCPLGFSGQFCNDLTPLCSSNPCANGGTCYQIGE-KFQCFCQPKYTGTTCSFPHRNMSLHLYER 269

Human   258 LPSGYGLAYRLTPGVHELPVQQPEHRILKVSMKE-LNKKTPLLTEGQAICFTILGVLTSLVVLGT 321
            ..|        .|..|    :.|:|.:||:::|| :....|||.:.|.|||.:||:||.|:||.|
 Frog   270 RNS--------LPSYH----KSPQHEVLKITVKETIQNVDPLLNKSQVICFIVLGLLTCLIVLIT 322

Human   322 VGIVFLNKCETWVSNLRYNHMLRKKKNLLLQYNSGEDLAVNIIFPEKI 369
            .||||.:|||||.:|.:|:.:||||||:.:|.:.|||..|.|||||.:
 Frog   323 TGIVFFSKCETWFANAKYSRLLRKKKNIYMQRSRGEDRDVKIIFPEGV 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DLK1NP_003827.4 EGF_CA 88..125 CDD:238011 17/36 (47%)
EGF_CA 135..168 CDD:238011 22/32 (69%)
EGF_CA 175..205 CDD:238011 17/29 (59%)
EGF_CA 212..245 CDD:238011 17/33 (52%)
dlk1XP_002936624.1 EGF_CA 98..134 CDD:238011 17/35 (49%)
EGF_CA 143..178 CDD:238011 23/34 (68%)
EGF_CA 182..217 CDD:238011 18/34 (53%)
EGF 224..252 CDD:333761 13/28 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 106 1.000 Domainoid score I28911
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H2846
Inparanoid 1 1.050 383 1.000 Inparanoid score I9332
NCBI 1 1.000 - -
OMA 1 1.010 - - QHG39048
OrthoDB 1 1.010 - - D148705at32523
OrthoFinder 1 1.000 - - FOG0012097
OrthoInspector 1 1.000 - - oto148774
Panther 1 1.100 - - LDO PTHR24052
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X10440
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1313.080

Return to query results.
Submit another query.