DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RGS11 and Axn

DIOPT Version :9

Sequence 1:XP_011521021.1 Gene:RGS11 / 8786 HGNCID:9993 Length:499 Species:Homo sapiens
Sequence 2:NP_733336.1 Gene:Axn / 43565 FlyBaseID:FBgn0026597 Length:745 Species:Drosophila melanogaster


Alignment Length:132 Identity:36/132 - (27%)
Similarity:63/132 - (47%) Gaps:14/132 - (10%)


- Green bases have known domain annotations that are detailed below.


Human   322 AAPTKLRVERWGFSFRELLEDPVGRAHFMDFLGKEFSGEN--LSFWEACEELRYGAQAQ-VPTLV 383
            ::|:.|   .|..:...||||..|...|..::.:|....|  |:|:.|||.|:.....: :..::
  Fly    44 SSPSYL---NWARTLNHLLEDRDGVELFKKYVEEEAPAYNDHLNFYFACEGLKQQTDPEKIKQII 105

Human   384 DAVYEQFLAPGAAHWVNIDSRTMEQTL----EGLRQPHRYVLDDAQLHIYMLMKKDSYPRFLKSD 444
            .|:| :||...... ::.|.|...:.:    |....||  :.|..|.|:.:.::.:.||.||.|:
  Fly   106 GAIY-RFLRKSQLS-ISDDLRAQIKAIKTNPEIPLSPH--IFDPMQRHVEVTIRDNIYPTFLCSE 166

Human   445 MY 446
            ||
  Fly   167 MY 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RGS11XP_011521021.1 DEP_RGS7-like 24..106 CDD:239897
GGL 255..316 CDD:128520
RGS_RGS11 327..452 CDD:188694 35/127 (28%)
AxnNP_733336.1 RGS 55..170 CDD:295367 33/118 (28%)
Axin_b-cat_bind 494..543 CDD:285982
DIX 665..739 CDD:279160
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3589
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.