DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SIGLEC5 and rig-5

DIOPT Version :9

Sequence 1:XP_016882908.1 Gene:SIGLEC5 / 8778 HGNCID:10874 Length:560 Species:Homo sapiens
Sequence 2:NP_001251131.1 Gene:rig-5 / 172791 WormBaseID:WBGene00004372 Length:482 Species:Caenorhabditis elegans


Alignment Length:349 Identity:68/349 - (19%)
Similarity:129/349 - (36%) Gaps:104/349 - (29%)


- Green bases have known domain annotations that are detailed below.


Human    56 LYVYWFRDGEIPYYAEVVATNNPDRRVKPETQGRFRLLGDVQKKNCSLSIGDARMEDTGSY---F 117
            :|::....|.:..:.:..:...|....:|.......|||......|.::       |.||:   |
 Worm    61 MYLFALLCGVLLVFKQACSRGAPPTIQQPSMSSAVALLGQDVDFTCIVN-------DLGSHMVAF 118

Human   118 FRVER-----GRDVKYSYQQNKLNLEVTALIEKP---DIH-----FLEPLESGRPTRLSCSLPGS 169
            .:.:.     ..|.|...::||..|       ||   |:|     .::.::.......||.:...
 Worm   119 VKADSPPRLLSFDEKVFRRRNKYEL-------KPRIGDLHNEWVLTIKNVQESDRGNYSCQINTE 176

Human   170 CEAGPPLTFSWTGNALSPLDPETTRSSELTLTPRPEDHGTNLTCQ----------MKRQGAQVTT 224
                 |:|.| ||.....:.|..:||:...:..| |.:..:|||:          .:||..|:  
 Worm   177 -----PITLS-TGELDVKVPPVVSRSTPAAVEVR-EGNNVSLTCKADGNPTPTVIWRRQDRQI-- 232

Human   225 ERTVQLN--------VSYAP-------------QTITIFRNGI------ALEILQNTSYLPVLEG 262
               ::.|        |.:.|             :.:.:..|||      .:::|  .::.|:::.
 Worm   233 ---IRYNGATGFGASVFHGPVLHLTKVSRKHMSEYLCVASNGIPPDESWTVKLL--VTFPPLVQA 292

Human   263 QA----------LRLLCDAPSNPPAHLSWFQ-GSPALNATPISNT----------GILELRRVRS 306
            |:          .|::|...:.|...:.|.: |.|...:..::.|          .|||:|.|:|
 Worm   293 QSETVQASVGSMARMVCTTEAWPRPEMGWEKDGEPVYESNNVAMTHTVSGQYHSVHILEIRNVQS 357

Human   307 AEEGGFTCRAQHPLGF--LQIFLN 328
            :..|.:.|.|::..|.  .|:.||
 Worm   358 SHFGVYRCVAKNDNGIHHSQVTLN 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SIGLEC5XP_016882908.1 None
rig-5NP_001251131.1 IG_like 92..189 CDD:214653 24/116 (21%)
Ig_3 191..270 CDD:372822 14/84 (17%)
IG 294..380 CDD:214652 18/85 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.