DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RAB11A and Rab11

DIOPT Version :9

Sequence 1:NP_004654.1 Gene:RAB11A / 8766 HGNCID:9760 Length:216 Species:Homo sapiens
Sequence 2:NP_477170.1 Gene:Rab11 / 42501 FlyBaseID:FBgn0015790 Length:214 Species:Drosophila melanogaster


Alignment Length:214 Identity:183/214 - (85%)
Similarity:193/214 - (90%) Gaps:0/214 - (0%)


- Green bases have known domain annotations that are detailed below.


Human     1 MGTRDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIW 65
            ||.|:||||||||||||||||||||||||||||||||||||||||||||||||:|||||||||||
  Fly     1 MGAREDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIEVDGKTIKAQIW 65

Human    66 DTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVIMLVGNKSDLRH 130
            |||||||||||||||||||||||||||||||||||||||||:|||||||.|||||||||||||||
  Fly    66 DTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLRELRDHADQNIVIMLVGNKSDLRH 130

Human   131 LRAVPTDEARAFAEKNGLSFIETSALDSTNVEAAFQTILTEIYRIVSQKQMSDRRENDMSPSNNV 195
            ||:||||||:.|||:|||||||||||||||||.|||.|||||||||||||:.|..|.|:...:||
  Fly   131 LRSVPTDEAKLFAERNGLSFIETSALDSTNVETAFQNILTEIYRIVSQKQIRDPPEGDVIRPSNV 195

Human   196 VPIHVPPTTENKPKVQCCQ 214
            .||.|.||.....:.||||
  Fly   196 EPIDVKPTVTADVRKQCCQ 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RAB11ANP_004654.1 Rab11_like 9..173 CDD:206660 154/163 (94%)
Rab11NP_477170.1 Rab11_like 9..173 CDD:206660 154/163 (94%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144707
Domainoid 1 1.000 302 1.000 Domainoid score I1400
eggNOG 1 0.900 - - E2759_KOG0087
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H37903
Inparanoid 1 1.050 363 1.000 Inparanoid score I2182
Isobase 1 0.950 - 0 Normalized mean entropy S128
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1133775at2759
OrthoFinder 1 1.000 - - FOG0000259
OrthoInspector 1 1.000 - - otm40982
orthoMCL 1 0.900 - - OOG6_100582
Panther 1 1.100 - - LDO PTHR47979
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5006
SonicParanoid 1 1.000 - - X277
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.740

Return to query results.
Submit another query.