DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PABPC4 and lark

DIOPT Version :10

Sequence 1:NP_001129125.1 Gene:PABPC4 / 8761 HGNCID:8557 Length:660 Species:Homo sapiens
Sequence 2:NP_523957.1 Gene:lark / 38811 FlyBaseID:FBgn0011640 Length:352 Species:Drosophila melanogaster


Alignment Length:175 Identity:48/175 - (27%)
Similarity:85/175 - (48%) Gaps:20/175 - (11%)


- Green bases have known domain annotations that are detailed below.


Human    96 SGVGNVFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDENGSKGYAFVHFETQEAADKAIEKMNG 160
            :|...:||.|||:......|...|..:|.::.|.||      |.|.|||.||::....||:.:||
  Fly     4 AGTFKLFIGNLDEKTQATELRALFEKYGTVVECDVV------KNYGFVHMETEQQGRDAIQNLNG 62

Human   161 MLLNDRKVFVGRFKSRKEREAELGAKAKEFTNVYIKNFGEEVDDESLKELFSQFGKTLSVKVMRD 225
            ..||:..:.|...|||:       |.....|.:::.|..::.....::|||.::|..:...::|:
  Fly    63 YTLNEFAIKVEAAKSRR-------APNTPTTKIFVGNLTDKTRAPEVRELFQKYGTVVECDIVRN 120

Human   226 PNGKSKGFGFVSYEKHEDANKAVEEMNGKEISGKIIFVGRAQKKV 270
                   :|||..:...|...|::|:||:.:.|:.:.|..:..:|
  Fly   121 -------YGFVHLDCVGDVQDAIKELNGRVVDGQPLKVQVSTSRV 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PABPC4NP_001129125.1 PABP-1234 11..640 CDD:130689 48/175 (27%)
larkNP_523957.1 RRM1_2_CoAA_like 8..73 CDD:409779 24/70 (34%)
RRM1_2_CoAA_like 87..152 CDD:409779 15/71 (21%)
hnRNP-R-Q <88..>258 CDD:273732 17/78 (22%)

Return to query results.
Submit another query.