DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ADAM18 and Meltrin

DIOPT Version :10

Sequence 1:NP_055052.1 Gene:ADAM18 / 8749 HGNCID:196 Length:739 Species:Homo sapiens
Sequence 2:NP_001027575.1 Gene:Meltrin / 3772109 FlyBaseID:FBgn0265140 Length:1407 Species:Drosophila melanogaster


Alignment Length:93 Identity:19/93 - (20%)
Similarity:43/93 - (46%) Gaps:21/93 - (22%)


- Green bases have known domain annotations that are detailed below.


Human   165 NREKEKN---------TQLKRRIEELESEVRDKEMELKD----LRKQSEI---IP-----QLMSE 208
            ||||..:         |.::..::|.:...|.|:::::.    .|:.|:|   :|     :..::
  Fly    69 NREKTHDVPNNWRNVCTAIETIMDEYQLMERKKKVQMQQHSTHNRQSSDICFKVPNQIRVKAQTK 133

Human   209 CEYVSEKLEAAERDNQNLEDKVRSLKTD 236
            |..::.:::..|...|..|:...||:.|
  Fly   134 CSDLASEMKRREAAIQEFENFFSSLEND 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ADAM18NP_055052.1 Pep_M12B_propep 27..141 CDD:460254
ZnMc_adamalysin_II_like 184..378 CDD:239797 13/65 (20%)
DISIN 399..476 CDD:214490
ACR 478..617 CDD:214743
MeltrinNP_001027575.1 Pep_M12B_propep 53..174 CDD:460254 19/93 (20%)
ZnMc_adamalysin_II_like 269..462 CDD:239797
Disintegrin 479..554 CDD:459709
ACR 558..701 CDD:214743
PHA03247 <823..1261 CDD:223021
PHA03247 <1220..1392 CDD:223021
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.