DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RIPK1 and SHO1

DIOPT Version :10

Sequence 1:XP_047275401.1 Gene:RIPK1 / 8737 HGNCID:10019 Length:712 Species:Homo sapiens
Sequence 2:NP_011043.1 Gene:SHO1 / 856854 SGDID:S000000920 Length:367 Species:Saccharomyces cerevisiae


Alignment Length:123 Identity:30/123 - (24%)
Similarity:50/123 - (40%) Gaps:30/123 - (24%)


- Green bases have known domain annotations that are detailed below.


Human   488 NAVHQPSGLTSQPQVLYQNNGLYS----SHGFGTRPLDPGTAGPRVWYRPIPSHMPSLHNIPVPE 548
            |::|:.....::....|||| :|:    ..|:.|:            :...|...||       .
Yeast   170 NSLHRARRRGNRNTTPYQNN-VYNDAIRDSGYATQ------------FDGYPQQQPS-------H 214

Human   549 TNYLGNTPTMPFSSLPP-TDESIKYTIYNSTGIQI-GAYNYMEIGGTSSSLLDSTNTN 604
            |||:.:|....|.:..| |.|::...: |:...:| .|.|..|....|:   :.||||
Yeast   215 TNYVSSTALAGFENTQPNTSEAVNLHL-NTLQQRINSASNAKETNDNSN---NQTNTN 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RIPK1XP_047275401.1 STKc_RIP1 64..331 CDD:270929
Death_RIP1 624..709 CDD:260048
SHO1NP_011043.1 SH3_Sho1p 304..358 CDD:212789
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.