DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GBF1 and step

DIOPT Version :9

Sequence 1:XP_006718110.1 Gene:GBF1 / 8729 HGNCID:4181 Length:1893 Species:Homo sapiens
Sequence 2:NP_001036375.2 Gene:step / 35425 FlyBaseID:FBgn0086779 Length:727 Species:Drosophila melanogaster


Alignment Length:374 Identity:106/374 - (28%)
Similarity:176/374 - (47%) Gaps:83/374 - (22%)


- Green bases have known domain annotations that are detailed below.


Human   594 SKNAFPVSGQLYTTHLLSLDALLTVIDSTEAHCQAKVLNSLTQQEKKETARPS------------ 646
            |||:.|....        :|.:..:.||:.:..::: .||...:..|.|::.:            
  Fly   283 SKNSLPPPPY--------IDDMRFIDDSSNSQSESE-RNSNIHKTNKYTSKNNNNDSKRESQQSN 338

Human   647 -CE----IVDGTREASNTERTASDGKAVGMASDIPGLHLPGGGRLPPEHGKSGCSDL---EEAVD 703
             ||    ::|  |...|||:  ||...:              .|.|.:..|....::   .||:|
  Fly   339 LCESCRMLLD--RNYINTEQ--SDNLVI--------------LRRPSKQIKDELCEVVSEMEALD 385

Human   704 SGADKKFARKPPRFSCLLPDPRELIEIKNKKKLLITGTEQFNQKPKKGIQFLQEKGLLTIPMDNT 768
            ...|.|.:                    ||.|.:..|.::||..|||||::|.|..||.  .|..
  Fly   386 VPEDCKHS--------------------NKDKQMSIGRKKFNMDPKKGIEYLVENRLLR--HDPQ 428

Human   769 EVAQWLRENPRLDKKMIGEFVSDRK--NIDLLESFVSTFSFQGLRLDEALRLYLEAFRLPGEAPV 831
            :||.:|.:...|:|..||:::.::.  |.|:|::||:...|..|.|.:|||.:|.:|||||||..
  Fly   429 DVAHFLYKGEGLNKTAIGDYLGEKNDFNEDVLKAFVALHDFTNLILVQALRQFLWSFRLPGEAQK 493

Human   832 IQRLLEAFTERWMNCNGSPFANSDACFSLAYAVIMLNTDQHNHNVRKQNAPMTLEEFRKNLKGVN 896
            |.|::|.|.:|:...|...|.|:|.|:.|::|:|||||..||.:|:.:   .|:::|....:|:|
  Fly   494 IDRMMETFAQRYCQLNPDIFTNTDTCYVLSFAIIMLNTSLHNPSVKDK---PTVDQFISMNRGIN 555

Human   897 GGKDFEQDILEDMYHAIKNEEIVMPEEQTGLVRENYVWNVLLHRGATPE 945
            .|.|..:.:||.:|.:|:.|...:|::.         .|.|:|....|:
  Fly   556 NGGDLPRGLLESLYESIRTEPFKIPQDD---------GNDLMHTFFNPD 595

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GBF1XP_006718110.1 Sec7_N 434..579 CDD:289549
Sec7 733..918 CDD:279680 72/186 (39%)
stepNP_001036375.2 Sec7 397..577 CDD:279680 71/184 (39%)
PH_GRP1-like 592..710 CDD:269954 1/4 (25%)
PH 596..708 CDD:278594 106/374 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5307
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D815698at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.