DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SERPINB7 and Spn88Eb

DIOPT Version :9

Sequence 1:NP_001035237.1 Gene:SERPINB7 / 8710 HGNCID:13902 Length:380 Species:Homo sapiens
Sequence 2:NP_650427.1 Gene:Spn88Eb / 41829 FlyBaseID:FBgn0038299 Length:426 Species:Drosophila melanogaster


Alignment Length:403 Identity:108/403 - (26%)
Similarity:188/403 - (46%) Gaps:53/403 - (13%)


- Green bases have known domain annotations that are detailed below.


Human    10 EFCFNLFREMDDNQGNGNVFFSSLSLFAALALVRLGAQDDSLSQIDKLLHVNTASGYGNSSNSQS 74
            :|...|.:::.:...:||:|||..|.:.||.|....:.:.:..::.:.|::      |.:.|.|.
  Fly    40 DFSLALMKQIREIYPSGNLFFSPFSTYNALLLAYFSSSEQTERELAQALNL------GWALNKQQ 98

Human    75 GLQS-QLKRVFSDINASHKDYDLSIVNGLFAEKVYGFHKDYIECAEK----LYDAKVERVDFTNH 134
            .|.| .|.:...:........:||..|.:|.::.       |..:.|    ||.|..| :||.|.
  Fly    99 VLVSYTLAQRQDEFRWRQSPMELSSANRIFVDRT-------INVSNKFNTLLYGATKE-LDFKND 155

Human   135 LEDTRRNINKWVENETHGKIKNVIGEGGISSSAVMVLVNAVYFKGKWQSAFTKSETINCHFKSPK 199
            .|...:.||.|:.::||.:|::::....|:...::||.||.|.||:|.|.|...||....|...:
  Fly   156 PETGLKEINDWIADKTHNQIRDMLSSEEITPHTMLVLANAAYMKGQWLSQFKVEETALKPFFINE 220

Human   200 CSGKAVAMMHQERKFNLSVIEDPSMKILELRY----------------NGGINMYVLLPEND--- 245
            ...:.|.|||:...|.:::.|....:|::|.|                ...|:|.::||.::   
  Fly   221 REQEMVYMMHKTGAFKMTIDEGLQSQIIKLPYRTIYKSKETHISTPESKSDISMIIILPNSNKIS 285

Human   246 LSEIENKLTFQNLMEWTNPRRMTSKYVEVFFPQFKIEKNYEMKQYLRALGLKDIFDESK--ADLS 308
            |:.:.::|...::.:|.  .|...:.:|:..|:|:.|:..|:...|..:|:..:|..:.  .||:
  Fly   286 LNRVISRLNADSVKKWF--ERALPQKIELSLPKFQFEQRLELTPILSLMGVNTMFTRNATFGDLT 348

Human   309 GIASGGRLYISRMMHKSYIEVTEEGTEATAATGSNIV----EKQLPQSTLFRADHPFLFVI--RK 367
              |....|.|....|.:.|:|.|.|:.|.|||   |:    ..:.|..|.|..:|||:|:|  .|
  Fly   349 --ADPISLVIDDAQHLAKIKVDEVGSTAAAAT---ILLVSRSSRQPDPTKFNCNHPFVFLIYDEK 408

Human   368 DDIILFSGKVSCP 380
            .|.|||:|..|.|
  Fly   409 VDTILFAGVYSDP 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SERPINB7NP_001035237.1 serpinB7_megsin 1..380 CDD:381032 107/401 (27%)
Spn88EbNP_650427.1 SERPIN 37..418 CDD:238101 106/398 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.