DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SERPINH1 and Spn42Dd

DIOPT Version :9

Sequence 1:NP_001193943.1 Gene:SERPINH1 / 871 HGNCID:1546 Length:418 Species:Homo sapiens
Sequence 2:NP_001163067.1 Gene:Spn42Dd / 49808 FlyBaseID:FBgn0028988 Length:372 Species:Drosophila melanogaster


Alignment Length:374 Identity:108/374 - (28%)
Similarity:180/374 - (48%) Gaps:40/374 - (10%)


- Green bases have known domain annotations that are detailed below.


Human    54 LYQAMAKDQAVENILVSPVVVASSLGLVSLGGKATTASQAKAVLSAEQLRDEEVHAGLGELLRSL 118
            :||.::|....:|::||||.:.:.|.:|.:|.:.:||.:.::.|.......|.|.|..|.||..|
  Fly    21 IYQLLSKSHTNQNLVVSPVSIETILSMVFMGAEGSTAKELQSALGLPSEDKEAVAARYGALLNDL 85

Human   119 SNSTARNVTWKLGSRLYGPSSVSFADDFVRSSKQHYNCEHSKINFRDKRSALQSINEWAAQTTDG 183
            .......:. ||.:|:|.....|...::..:.::.:..|...|:..:...|.:.||:|....|.|
  Fly    86 QGQEEGPIL-KLANRIYVNDQYSLNQNYNLAVREPFKSEAESISLTNGPVAAERINQWVLDQTSG 149

Human   184 KLP------EVTKDVERTDGALLVNAMFFKPHWDEKFHHKMVDNRGFMVTRSYTVGVMMMHRTGL 242
            |:.      .:|.||:    ||||||::||..|:.||.........|.||.:.:|.|.||.:.|.
  Fly   150 KIKGMIDPGSMTSDVK----ALLVNAIYFKGQWESKFDPAKTRASTFQVTANKSVPVQMMAQMGT 210

Human   243 Y--NYYDDEKEKLQIVEMPLAHKLSSLIILMPHHVEPLERLEKLLTKEQLKIWMGKMQKKAVAIS 305
            :  ||:.|  ...|::|:|..:...|:.|.:|..||.|..||     |::..:...:..|.|.:.
  Fly   211 FRANYFRD--LDAQVIELPYLNSNLSMTIFLPREVEGLSALE-----EKIVGFARPLVAKEVYLK 268

Human   306 LPKGVVEVTHDLQKHLAGLGLTEAIDKNKADLSRM----SGKKDLYLASVFHATAFELDTDGNPF 366
            |||..:|...:|::.|..||:.| :..:|:|||.:    ||.|   ::.|.|....|::.:|   
  Fly   269 LPKFKIEFRDELKETLEKLGIRE-LFTDKSDLSGLFADKSGGK---VSQVSHKAFLEVNEEG--- 326

Human   367 DQDIYGREELRSPK------LFYADHPFIFLVRDTQSGSLLFIGRLVRP 409
             .:..|...:....      ...|||||.|::||  :.::.|.||:|.|
  Fly   327 -AEAAGATSVAVTNRAGFSTFLMADHPFAFVIRD--ANTIYFQGRVVSP 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SERPINH1NP_001193943.1 serpinH1_CBP1 36..417 CDD:381003 108/374 (29%)
Prevents secretion from ER. /evidence=ECO:0000255|PROSITE-ProRule:PRU10138 415..418
Spn42DdNP_001163067.1 SERPIN 16..369 CDD:238101 105/369 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.