DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SERPINH1 and Spn88Eb

DIOPT Version :9

Sequence 1:NP_001193943.1 Gene:SERPINH1 / 871 HGNCID:1546 Length:418 Species:Homo sapiens
Sequence 2:NP_650427.1 Gene:Spn88Eb / 41829 FlyBaseID:FBgn0038299 Length:426 Species:Drosophila melanogaster


Alignment Length:458 Identity:102/458 - (22%)
Similarity:174/458 - (37%) Gaps:90/458 - (19%)


- Green bases have known domain annotations that are detailed below.


Human     3 SLLLLSAFCLLEAALAAEVKKPAAAAAPGTAEKLSPKAATLAERSAGLA---------------- 51
            ||:||:   ||.....|.:.||..:.....::...      .||...||                
  Fly     5 SLVLLA---LLPVVTIAALDKPELSFLNEFSQIFK------GERDFSLALMKQIREIYPSGNLFF 60

Human    52 --FSLYQAM-----AKDQAVENILVSPVVVASSLGLVSLGGKATTASQAKAVLSAEQLRDE---- 105
              ||.|.|:     :..:..|..|      |.:|.|    |.|....|.....:..|.:||    
  Fly    61 SPFSTYNALLLAYFSSSEQTEREL------AQALNL----GWALNKQQVLVSYTLAQRQDEFRWR 115

Human   106 EVHAGLGELLRSLSNSTARNVTWKLGSRLYGPSSVSFADDFVRSSKQHYNCEHSKINFR-DKRSA 169
            :....|....|...:.|. ||:.|..:.|||.:                    .:::|: |..:.
  Fly   116 QSPMELSSANRIFVDRTI-NVSNKFNTLLYGAT--------------------KELDFKNDPETG 159

Human   170 LQSINEWAAQTTDGKLPEVTKDVERTDGALLV--NAMFFKPHWDEKFHHKMVDNRGFMVTRSYTV 232
            |:.||:|.|..|..::.::....|.|...:||  ||.:.|..|..:|..:....:.|.:......
  Fly   160 LKEINDWIADKTHNQIRDMLSSEEITPHTMLVLANAAYMKGQWLSQFKVEETALKPFFINEREQE 224

Human   233 GVMMMHRTGLYNYYDDEKEKLQIVEMPL--------AHKLS-------SLIILMPHHVE-PLERL 281
            .|.|||:||.:....||..:.||:::|.        .|..:       |:||::|:..: .|.|:
  Fly   225 MVYMMHKTGAFKMTIDEGLQSQIIKLPYRTIYKSKETHISTPESKSDISMIIILPNSNKISLNRV 289

Human   282 EKLLTKEQLKIWMGKMQKKAVAISLPKGVVEVTHDLQKHLAGLGLTEAIDKNKADLSRMSGKKDL 346
            ...|..:.:|.|..:...:.:.:||||...|...:|...|:.:|:.....:|.......:....|
  Fly   290 ISRLNADSVKKWFERALPQKIELSLPKFQFEQRLELTPILSLMGVNTMFTRNATFGDLTADPISL 354

Human   347 YLASVFHATAFELDTDGNPFDQD---IYGREELR-SPKLFYADHPFIFLVRDTQSGSLLFIGRLV 407
            .:....|....::|..|:.....   :..|...: .|..|..:|||:||:.|.:..::||.|...
  Fly   355 VIDDAQHLAKIKVDEVGSTAAAATILLVSRSSRQPDPTKFNCNHPFVFLIYDEKVDTILFAGVYS 419

Human   408 RPK 410
            .|:
  Fly   420 DPR 422

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SERPINH1NP_001193943.1 serpinH1_CBP1 36..417 CDD:381003 93/425 (22%)
Prevents secretion from ER. /evidence=ECO:0000255|PROSITE-ProRule:PRU10138 415..418
Spn88EbNP_650427.1 SERPIN 37..418 CDD:238101 92/411 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.