DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment B3GALNT1 and brn

DIOPT Version :9

Sequence 1:NP_001336091.1 Gene:B3GALNT1 / 8706 HGNCID:918 Length:451 Species:Homo sapiens
Sequence 2:NP_476901.1 Gene:brn / 31358 FlyBaseID:FBgn0000221 Length:325 Species:Drosophila melanogaster


Alignment Length:301 Identity:77/301 - (25%)
Similarity:135/301 - (44%) Gaps:56/301 - (18%)


- Green bases have known domain annotations that are detailed below.


Human   175 YEPIYRQDFHFTLREHSNCS-----------------------HQNPFLVILVTSHPSDVKARQA 216
            :|..:.:.||:.|.:.:...                       .|...|.:|:.|...:.:.|:|
  Fly    32 HELNFERHFHYPLNDDTGSGSASSGLDKFAYLRVPSFTAEVPVDQPARLTMLIKSAVGNSRRREA 96

Human   217 IRVTWGEKKSWWGYEVLTFFLLGQEAEKEDKMLALSLEDEHLLYGDIIRQDFLDTYNNLTLKTIM 281
            ||.|||.:..:....:...|||| .||..:|.:|....:    :|||::.:|.|.|.|.||||::
  Fly    97 IRRTWGYEGRFSDVHLRRVFLLG-TAEDSEKDVAWESRE----HGDILQAEFTDAYFNNTLKTML 156

Human   282 AFRWVTEFCPNAKYVMKTDTDVFINTGNLVKYL---LNLNHSEKFFTGYPLIDNYSYRGFYQKTH 343
            ..||.::....:::.:..|.|.:::..|::|:|   ...:..|..|.|: :......|..:.|.:
  Fly   157 GMRWASDQFNRSEFYLFVDDDYYVSAKNVLKFLGRGRQSHQPELLFAGH-VFQTSPLRHKFSKWY 220

Human   344 ISYQEYPFKVFPPYCSGLGYIMSRDLVPRIYEMMGHVKPIKFEDVYVGICLNLLKVNIHIPEDTN 408
            :|.:||||..:|||.:...:|:|:..:.::|....|:...:|:|||:||.  .||..|.:.    
  Fly   221 VSLEEYPFDRWPPYVTAGAFILSQKALRQLYAASVHLPLFRFDDVYLGIV--ALKAGISLQ---- 279

Human   409 LFFLYRIHLDVCQLRR-----------VIAAHGFSSKEIIT 438
                   |.|..:..|           |||:|.|...|.:|
  Fly   280 -------HCDDFRFHRPAYKGPDSYSSVIASHEFGDPEEMT 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
B3GALNT1NP_001336091.1 Galactosyl_T 212..405 CDD:250845 59/195 (30%)
brnNP_476901.1 Galactosyl_T 92..282 CDD:250845 60/208 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165156982
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2287
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 1 1.000 - - FOG0000088
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11214
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X41
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
87.810

Return to query results.
Submit another query.