DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment JRKL and cag

DIOPT Version :9

Sequence 1:NP_001248762.1 Gene:JRKL / 8690 HGNCID:6200 Length:524 Species:Homo sapiens
Sequence 2:NP_001260876.1 Gene:cag / 36157 FlyBaseID:FBgn0017414 Length:225 Species:Drosophila melanogaster


Alignment Length:176 Identity:49/176 - (27%)
Similarity:90/176 - (51%) Gaps:17/176 - (9%)


- Green bases have known domain annotations that are detailed below.


Human     4 KRKRVVLTIKDKLDIIKKLEDGG-SSKQLAVIYGIGETTVRDIRKNKEKIITYASSSDSTSLLAK 67
            ::.|..||:::|:::|:..|... |.:.||..:.||:|...||.|:|:. |.....|....|...
  Fly     7 RKPRTSLTLEEKMEVIQSQERNKLSVRDLAKRFNIGKTQAADILKHKQS-IKEGLLSGELKLNQM 70

Human    68 RKSMKPSMYEELDRAMLEWFNQQRAKGNPISGPICAKRAEFFFYALGMDGDFNPSAGWLTRFKQR 132
            |::.......::|....:||::.|.:..||||.:..|:|:.....|| ..:|:.|:|||.::::|
  Fly    71 RRNPLSQRGAQIDEMCFDWFSRVRTENIPISGEMVRKKAKQLAVELG-HSNFSASSGWLEKWRKR 134

Human   133 HSIREINIRNERLNGDETAVEDFCNNFRDFIERENLQPEQIYNADE 178
            |::|    .|:  .||...:::|        |...::.|.|.|.|:
  Fly   135 HNVR----YND--TGDSLDLQEF--------EAILVKSEPISNKDD 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
JRKLNP_001248762.1 HTH 4..52 CDD:304362 16/48 (33%)
CENPB 73..139 CDD:197828 20/65 (31%)
DDE_1 206..385 CDD:281213
cagNP_001260876.1 CENP-B_N 7..60 CDD:282122 17/53 (32%)
CENPB 78..141 CDD:197828 20/67 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3105
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1343623at2759
OrthoFinder 1 1.000 - - FOG0000365
OrthoInspector 1 1.000 - - otm40429
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.