DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment KRT38 and LamC

DIOPT Version :9

Sequence 1:NP_006762.3 Gene:KRT38 / 8687 HGNCID:6456 Length:456 Species:Homo sapiens
Sequence 2:NP_001260974.1 Gene:LamC / 36615 FlyBaseID:FBgn0010397 Length:640 Species:Drosophila melanogaster


Alignment Length:458 Identity:119/458 - (25%)
Similarity:194/458 - (42%) Gaps:109/458 - (23%)


- Green bases have known domain annotations that are detailed below.


Human    59 STPLGRPSL-----CLPPTCHTACPLPGTCHIPGNIGICGAYGENTLNGHEKETMQFLNDRLANY 118
            |||:|..|.     ...||..|                      .|....|||.:|.||||||.|
  Fly    18 STPVGGASTSSRVGATSPTSPT----------------------RTSRQQEKEELQHLNDRLACY 60

Human   119 LEKVRQLEQENAEL--EATLLERSKCHESTVCPDYQSYFHTIEELQQKILCSKA-ENARLIVQI- 179
            ::::|.||.||:.|  |..|.:.:...|::   :.::.:.......:|:|...| |.|:|.:.| 
  Fly    61 IDRMRNLENENSRLTQELNLAQDTVNRETS---NLKAVYEKELAAARKLLDETAKEKAKLEIDIK 122

Human   180 ------------------------DNAKLAADDF----------------------RIKLESERS 198
                                    :||:|..:.:                      .:.||:||.
  Fly   123 RLWEENDDLKPRLDKKTKEATVAENNARLYENRYNEVNGKYNQSLADRKKFEDQAKELALENERL 187

Human   199 LRQLVEADKCGTQKLLDDATLAKADLEAQQESLKEEQLSLKSN-HEQEVKILRSQLGEKLRIEL- 261
            .|||.:     .:|.|:..|||:.|||.|.:||:|| |:.|.. |.||:...||    :.:||: 
  Fly   188 RRQLDD-----LRKQLEAETLARVDLENQNQSLREE-LAFKDQVHTQELTETRS----RRQIEIS 242

Human   262 DIEPTID------LNRVLGEMRAQYEAMLETNRQDVEQWFQAQSEGISLQDMSCSEELQCCQSEI 320
            :|:..:.      |.:.|.|:|.|||..:..||:::|..:..:.:.:.......::.......|:
  Fly   243 EIDGRLSRQYEAKLQQSLQELRDQYEGQMRINREEIELLYDNEIQNLKAAANRAAQGSALATEEV 307

Human   321 LELRCTVNALEVERQAQHTLKDCLQNSLCEAEDRFGTELAQMQSLISNVEEQLSEIRADLERQNQ 385
            ..:|..::.|..:.|........|...:.|.|:...||..:....|:::|.:|..:|.::..|.|
  Fly   308 RLMRTKIDGLNAKLQNLEDTNAGLNARIRELENLLDTERQRHNQYIASLEAELQRMRDEMAHQLQ 372

Human   386 EYQVLLDVKTRLENEIATYRNLLESEDCKL----PCNP-----CSTSPSCVTAPCAPRPSCGPCT 441
            |||.|:|:|..|:.|||.|..||..|:.:|    |..|     .|::.|.:||..:.|  .|..|
  Fly   373 EYQGLMDIKVSLDLEIAAYDKLLCGEERRLNIESPGRPTTDSGISSNGSHLTASASSR--SGRVT 435

Human   442 TCG 444
            ..|
  Fly   436 PSG 438

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KRT38NP_006762.3 Head 1..104 9/49 (18%)
Filament 104..414 CDD:278467 99/367 (27%)
Coil 1A 105..139 18/35 (51%)
Linker 1 140..150 1/9 (11%)
Coil 1B 151..251 35/148 (24%)
Spc24 204..>273 CDD:285486 24/76 (32%)
Linker 12 252..267 3/15 (20%)
Coil 2 268..411 38/148 (26%)
Tail 412..456 11/42 (26%)
LamCNP_001260974.1 Filament 45..401 CDD:278467 99/368 (27%)
ATP-synt_B <67..>142 CDD:304375 15/77 (19%)
MreC <178..>224 CDD:302802 22/51 (43%)
LTD 473..574 CDD:279300
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.