DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment KRT38 and CG31533

DIOPT Version :9

Sequence 1:NP_006762.3 Gene:KRT38 / 8687 HGNCID:6456 Length:456 Species:Homo sapiens
Sequence 2:NP_731887.1 Gene:CG31533 / 318788 FlyBaseID:FBgn0051533 Length:844 Species:Drosophila melanogaster


Alignment Length:278 Identity:53/278 - (19%)
Similarity:95/278 - (34%) Gaps:107/278 - (38%)


- Green bases have known domain annotations that are detailed below.


Human    21 RNVSVSPIDIGCQPGAEANIAPMCLLANVAHANRVRVGSTPLGRPSLCLPPTC-------HTACP 78
            |::|::|:..|         .|:.:.:::.|      |..|:....:||   |       :..||
  Fly   293 RSLSLAPVKSG---------IPVSVRSDLLH------GVKPIRFCPVCL---CSMSWMPKYAPCP 339

Human    79 LPGTCHIPGNIGICGAYGENTLNGHEKETM---QFLNDRLAN-------------YLEKVRQLEQ 127
            ...|..:|            .|.||..|.:   :.|.::|..             ..||||:...
  Fly   340 QCNTKAVP------------ILQGHPIENITAEEILAEQLVKPKAPPGVEDFCEPPCEKVRRKIW 392

Human   128 ENAELEATLLERSKCHESTVCPDYQSYFHTIEELQQKILCSKA--ENARLIVQIDNAKLAADDFR 190
            .:.|....   |..|.:...||..:     |.::...|..:|:  :..|.|.:    ..:::||.
  Fly   393 NDTECPPC---RCTCSKGNTCPHCR-----IRKMCDDIFTAKSPPKPPRRIPK----PRSSEDFC 445

Human   191 IKLESE------------RSLRQLVE----------ADKCGTQKLLDDATLAKADLEAQQESLKE 233
            :.:|||            ..|:.|..          .::|.:|.|.   |:      ..:.|:||
  Fly   446 VVMESEGEDDLPYLAKVFSELKNLYHIHDTKKLSAIKERCASQSLF---TI------RSRRSIKE 501

Human   234 EQLSL---------KSNH 242
            ...||         :|:|
  Fly   502 LTKSLYPGDKILDGRSHH 519

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KRT38NP_006762.3 Head 1..104 17/89 (19%)
Filament 104..414 CDD:278467 35/188 (19%)
Coil 1A 105..139 8/49 (16%)
Linker 1 140..150 2/9 (22%)
Coil 1B 151..251 23/125 (18%)
Spc24 204..>273 CDD:285486 11/58 (19%)
Linker 12 252..267
Coil 2 268..411
Tail 412..456
CG31533NP_731887.1 DUF4788 12..260 CDD:292651
DUF4776 315..758 CDD:292622 47/241 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28M49
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.