DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SRSF9 and trv

DIOPT Version :10

Sequence 1:NP_003760.1 Gene:SRSF9 / 8683 HGNCID:10791 Length:221 Species:Homo sapiens
Sequence 2:NP_001163754.3 Gene:trv / 43362 FlyBaseID:FBgn0085391 Length:651 Species:Drosophila melanogaster


Alignment Length:195 Identity:44/195 - (22%)
Similarity:73/195 - (37%) Gaps:51/195 - (26%)


- Green bases have known domain annotations that are detailed below.


Human    16 IYVGNLPTDVREKDLEDLFYKYGRIREIE-------LKNRHGLVPFAFVRFEDPRDAEDAIYGRN 73
            |:||:|.:::..:.|.:.|..:|.|.:..       ||::    .:.||.|....:||.||...|
  Fly   314 IFVGDLSSEIETQQLREAFTPFGEISDCRVVRDPQTLKSK----GYGFVSFIKKSEAESAITAMN 374

Human    74 GYDYGQCRLR-----------------VEFPRTYGGRGGWPR------GGRNGPPTRRSDFRVLV 115
            |...|...:|                 :.|...|....  |.      ||.|...|..|: .||.
  Fly   375 GQWLGSRSIRTNWATRKPPASKENIKPLTFDEVYNQSS--PSNCTVYVGGVNSALTALSE-EVLQ 436

Human   116 SGLPPSGSWQDLKDHMREAGDVCYADVQKD-GVGMVEYLRKEDMEYALRKLDDTKFRSHEGETSY 179
            ....|.|:.|:::             |.|| |...|.:..||...:|:..:.:|:..:...:.|:
  Fly   437 KTFAPYGAIQEIR-------------VFKDKGYAFVRFSTKEAATHAIVGVHNTEINAQPVKCSW 488

Human   180  179
              Fly   489  488

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SRSF9NP_003760.1 RRM1_SRSF9 15..86 CDD:241042 21/93 (23%)
RRM2_SRSF9 104..186 CDD:410161 17/77 (22%)
Interaction with SAFB1 188..200
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 189..221
trvNP_001163754.3 RRM2_TIA1_like 313..387 CDD:409789 21/76 (28%)
RRM3_TIA1_like 416..489 CDD:409790 20/87 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.