DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SRSF9 and lark

DIOPT Version :10

Sequence 1:NP_003760.1 Gene:SRSF9 / 8683 HGNCID:10791 Length:221 Species:Homo sapiens
Sequence 2:NP_523957.1 Gene:lark / 38811 FlyBaseID:FBgn0011640 Length:352 Species:Drosophila melanogaster


Alignment Length:259 Identity:66/259 - (25%)
Similarity:90/259 - (34%) Gaps:85/259 - (32%)


- Green bases have known domain annotations that are detailed below.


Human    15 RIYVGNLPTDVREKDLEDLFYKYGRIREIELKNRHGLVPFAFVRFEDPRDAEDAIYGRNGY---- 75
            :|:||||....|..::.:||.|||.:.|.::...:|     ||..:...|.:|||...||.    
  Fly    87 KIFVGNLTDKTRAPEVRELFQKYGTVVECDIVRNYG-----FVHLDCVGDVQDAIKELNGRVVDG 146

Human    76 -------------------DYGQC-------RLRVEFPRTYGGRGGWPRGGRNGP-PTRRSDFRV 113
                               |..||       ....|.||.||..|    |||..| |.....:|.
  Fly   147 QPLKVQVSTSRVRPKPGMGDPEQCYRCGRSGHWSKECPRLYGSAG----GGREPPSPLSAGGYRD 207

Human   114 LVSGL----PPSGSWQDLKDHMREAGDVCYADVQKDGVGMVEYLRKEDMEYALRKLDDTK-FRSH 173
            .:.|.    ||......|:|.:            .||.        .|.:|..|:.:|:: ....
  Fly   208 RMYGRDPYPPPPPPPPFLRDRI------------MDGF--------RDYDYYDRRFEDSRDLYER 252

Human   174 EGETSYIRVYPE-----------RSTSYGYSRSRSGSRGRDS---------PYQSRGSPHYFSP 217
            ..:||.:|.:|.           ..|..|..||.|.|||.|:         |..|.|...|.||
  Fly   253 RYQTSRMRDFPPPPISRREPMPLPPTLSGSLRSCSVSRGYDTMFSRRSPPPPRSSNGMSRYGSP 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SRSF9NP_003760.1 RRM1_SRSF9 15..86 CDD:241042 24/100 (24%)
RRM2_SRSF9 104..186 CDD:410161 18/98 (18%)
Interaction with SAFB1 188..200 5/11 (45%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 189..221 14/38 (37%)
larkNP_523957.1 RRM1_2_CoAA_like 8..73 CDD:409779
RRM1_2_CoAA_like 87..152 CDD:409779 21/69 (30%)
hnRNP-R-Q <88..>258 CDD:273732 48/198 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.