DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SRSF9 and nito

DIOPT Version :9

Sequence 1:NP_003760.1 Gene:SRSF9 / 8683 HGNCID:10791 Length:221 Species:Homo sapiens
Sequence 2:NP_001286174.1 Gene:nito / 35756 FlyBaseID:FBgn0027548 Length:793 Species:Drosophila melanogaster


Alignment Length:264 Identity:61/264 - (23%)
Similarity:88/264 - (33%) Gaps:106/264 - (40%)


- Green bases have known domain annotations that are detailed below.


Human    16 IYVGNLPTDVREKDLEDLFYKYGRIREIELKNRHGLVP-------FAFVRFEDPRDAEDAIYGRN 73
            ::.|||...:.:.:|..:|.|||.:.:|::|.     |       |||||:::...|..|....:
  Fly   316 LFAGNLEVTIADDELRRIFGKYGVVDDIDIKR-----PPPGTGNAFAFVRYQNLDMAHRAKIELS 375

Human    74 GYDYGQCRLRVEF----PRT---YGGRGGWP---------------------------------- 97
            |...|:.:.::.:    |.|   .||.|.|.                                  
  Fly   376 GQYIGKFQCKIGYGKVTPATRMWIGGLGAWTSVTQLEREFDRFGAIKKIEYQKGEPYAYIQYETV 440

Human    98 ----------RGGRNGPPTR--RSDFRVLVSGLPPSGSWQDLKDHMREAGDVCYADVQKDGVGMV 150
                      ||...|.|.|  |:||..| .|..|:..::..|....|:.              :
  Fly   441 EAATAAVKEMRGFPLGGPERRLRTDFAEL-PGATPAAPFKSSKPPYDESA--------------L 490

Human   151 EYLRKEDMEYALRKLDDTKFRSHEGETSY-----IRVYPERSTSYGYSRSRSGSRGRDSPYQSRG 210
            ||.|.|...|            :|...:|     ...||.|.   || |.|.|.|||     .||
  Fly   491 EYRRPEYDPY------------YEESAAYAPRGGYSPYPPRG---GY-RGRGGYRGR-----GRG 534

Human   211 SPHY 214
            ..||
  Fly   535 MYHY 538

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SRSF9NP_003760.1 RRM1_SRSF9 15..86 CDD:241042 20/76 (26%)
RRM2_SRSF9 104..186 CDD:410161 19/88 (22%)
Interaction with SAFB1 188..200 5/11 (45%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 189..221 12/26 (46%)
nitoNP_001286174.1 RRM <56..>223 CDD:223796
RRM1_Spen 98..175 CDD:240754
RRM2_Spen 312..390 CDD:240755 20/78 (26%)
RRM3_Spen 397..467 CDD:240756 11/69 (16%)
SPOC 630..789 CDD:311609
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.