DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SRSF9 and Rbp1-like

DIOPT Version :10

Sequence 1:NP_003760.1 Gene:SRSF9 / 8683 HGNCID:10791 Length:221 Species:Homo sapiens
Sequence 2:NP_001188585.1 Gene:Rbp1-like / 32293 FlyBaseID:FBgn0030479 Length:247 Species:Drosophila melanogaster


Alignment Length:92 Identity:40/92 - (43%)
Similarity:54/92 - (58%) Gaps:6/92 - (6%)


- Green bases have known domain annotations that are detailed below.


Human    15 RIYVGNLPTDVREKDLEDLFYKYGRIREIEL-KNRHGLVPFAFVRFEDPRDAEDAIYGRNGYDYG 78
            ::|||||.:...:.::|:.|.|||.:|.:.: :|..|   ||||.|||.||||||..|.:|....
  Fly    12 KVYVGNLGSSASKYEIENAFSKYGPLRNVWVARNPPG---FAFVEFEDRRDAEDATRGLDGTRCC 73

Human    79 QCRLRVEFP--RTYGGRGGWPRGGRNG 103
            ..|:|||..  |:..||||...||..|
  Fly    74 GTRIRVEMSSGRSREGRGGGGGGGGGG 100

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SRSF9NP_003760.1 RRM1_SRSF9 15..86 CDD:241042 31/71 (44%)
RRM2_SRSF9 104..186 CDD:410161 40/92 (43%)
Interaction with SAFB1 188..200
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 189..221
Rbp1-likeNP_001188585.1 RRM_SRSF3_like 12..81 CDD:409808 31/71 (44%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.