DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PEA15 and Pea15

DIOPT Version :9

Sequence 1:NP_001284505.1 Gene:PEA15 / 8682 HGNCID:8822 Length:151 Species:Homo sapiens
Sequence 2:NP_001013249.1 Gene:Pea15 / 364052 RGDID:1306055 Length:130 Species:Rattus norvegicus


Alignment Length:130 Identity:130/130 - (100%)
Similarity:130/130 - (100%) Gaps:0/130 - (0%)


- Green bases have known domain annotations that are detailed below.


Human    22 MAEYGTLLQDLTNNITLEDLEQLKSACKEDIPSEKSEEITTGSAWFSFLESHNKLDKDNLSYIEH 86
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Rat     1 MAEYGTLLQDLTNNITLEDLEQLKSACKEDIPSEKSEEITTGSAWFSFLESHNKLDKDNLSYIEH 65

Human    87 IFEISRRPDLLTMVVDYRTRVLKISEEDELDTKLTRIPSAKKYKDIIRQPSEEEIIKLAPPPKKA 151
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Rat    66 IFEISRRPDLLTMVVDYRTRVLKISEEDELDTKLTRIPSAKKYKDIIRQPSEEEIIKLAPPPKKA 130

Human   152  151
              Rat   131  130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PEA15NP_001284505.1 DED_PEA15 23..106 CDD:260045 82/82 (100%)
Pea15NP_001013249.1 DED_PEA15 2..85 CDD:260045 82/82 (100%)
Microtubule-binding. /evidence=ECO:0000255 98..107 8/8 (100%)
Microtubule-binding. /evidence=ECO:0000255 122..129 6/6 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C83692877
Domainoid 1 1.000 166 1.000 Domainoid score I29318
eggNOG 1 0.900 - - E1_KOG3573
HGNC 1 1.500 - -
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H7884
Inparanoid 1 1.050 259 1.000 Inparanoid score I15111
NCBI 1 1.000 - -
OMA 1 1.010 - - QHG43586
OrthoDB 1 1.010 - - D1425994at2759
OrthoFinder 1 1.000 - - FOG0010563
OrthoInspector 1 1.000 - - oto136053
orthoMCL 1 0.900 - - OOG6_116231
Panther 1 1.100 - - LDO PTHR48169
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X8057
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1616.310

Return to query results.
Submit another query.