DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sfp33A3 and Spink14

DIOPT Version :10

Sequence 1:NP_001162959.1 Gene:Sfp33A3 / 8674115 FlyBaseID:FBgn0259964 Length:99 Species:Drosophila melanogaster
Sequence 2:NP_001034307.2 Gene:Spink14 / 433178 MGIID:3646952 Length:96 Species:Mus musculus


Alignment Length:33 Identity:12/33 - (36%)
Similarity:18/33 - (54%) Gaps:1/33 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 CNLIYRPLCASNSKTYNNYCEFKCE-VKRGSPI 57
            |..:.:|:|.:|..||:|.|....| :|.|..|
Mouse    56 CPDLKQPICGTNFVTYDNPCILCVESLKSGGRI 88

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sfp33A3NP_001162959.1 KAZAL_FS 26..65 CDD:238052 12/33 (36%)
Spink14NP_001034307.2 KAZAL_FS 55..96 CDD:412159 12/33 (36%)

Return to query results.
Submit another query.