DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sfp33A3 and CG45011

DIOPT Version :10

Sequence 1:NP_001162959.1 Gene:Sfp33A3 / 8674115 FlyBaseID:FBgn0259964 Length:99 Species:Drosophila melanogaster
Sequence 2:NP_001285848.1 Gene:CG45011 / 19835723 FlyBaseID:FBgn0266363 Length:67 Species:Drosophila melanogaster


Alignment Length:69 Identity:29/69 - (42%)
Similarity:36/69 - (52%) Gaps:9/69 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 YLP-FIAFFLFALLALS---VGEEFCNCNLIYRPLCASNSKTYNNYCEFKC--EVKRGSPITVVK 61
            |.| |||..|.|.:.|:   |....|.|..||.|:|.|:..||.|.||.||  ::|.   |.|||
  Fly     2 YSPIFIALCLLAFVVLTEAQVTRPLCPCPRIYFPVCGSDHVTYTNSCELKCAAQIKL---IYVVK 63

  Fly    62 WKQC 65
            ..:|
  Fly    64 AGRC 67

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sfp33A3NP_001162959.1 KAZAL_FS 26..65 CDD:238052 18/40 (45%)
CG45011NP_001285848.1 KAZAL 27..67 CDD:197624 19/42 (45%)

Return to query results.
Submit another query.