DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment inaF-B and inaF-A

DIOPT Version :9

Sequence 1:NP_001162726.1 Gene:inaF-B / 8674114 FlyBaseID:FBgn0259918 Length:81 Species:Drosophila melanogaster
Sequence 2:NP_001096960.1 Gene:inaF-A / 5740676 FlyBaseID:FBgn0085351 Length:89 Species:Drosophila melanogaster


Alignment Length:72 Identity:31/72 - (43%)
Similarity:49/72 - (68%) Gaps:7/72 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 KEAKDEEIPMPKSND---FFESKTFRLLTLLLYMGGVSGMGLTLAVYYLFIWDSRMPPL----PV 73
            |..:::::.:||...   ||||||||::::.||:||:||:|:.||:|||..:||.||.:    ||
  Fly    11 KPEENDDVRLPKEQQPPAFFESKTFRIISIFLYLGGISGLGMVLALYYLMFFDSSMPDIHLKFPV 75

  Fly    74 FKHTHPI 80
            ....||:
  Fly    76 SIGGHPV 82

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
inaF-BNP_001162726.1 InaF-motif 34..68 CDD:291678 19/33 (58%)
inaF-ANP_001096960.1 InaF-motif 32..66 CDD:291678 19/33 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2F7FF
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0016621
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.