powered by:
Protein Alignment inaF-B and inaF-A
DIOPT Version :9
Sequence 1: | NP_001162726.1 |
Gene: | inaF-B / 8674114 |
FlyBaseID: | FBgn0259918 |
Length: | 81 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001096960.1 |
Gene: | inaF-A / 5740676 |
FlyBaseID: | FBgn0085351 |
Length: | 89 |
Species: | Drosophila melanogaster |
Alignment Length: | 72 |
Identity: | 31/72 - (43%) |
Similarity: | 49/72 - (68%) |
Gaps: | 7/72 - (9%) |
- Green bases have known domain annotations that are detailed below.
Fly 16 KEAKDEEIPMPKSND---FFESKTFRLLTLLLYMGGVSGMGLTLAVYYLFIWDSRMPPL----PV 73
|..:::::.:||... ||||||||::::.||:||:||:|:.||:|||..:||.||.: ||
Fly 11 KPEENDDVRLPKEQQPPAFFESKTFRIISIFLYLGGISGLGMVLALYYLMFFDSSMPDIHLKFPV 75
Fly 74 FKHTHPI 80
....||:
Fly 76 SIGGHPV 82
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_2F7FF |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0016621 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.810 |
|
Return to query results.
Submit another query.