DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42514 and mfsd14ba

DIOPT Version :9

Sequence 1:NP_730171.1 Gene:CG42514 / 8674108 FlyBaseID:FBgn0260388 Length:533 Species:Drosophila melanogaster
Sequence 2:XP_002663499.2 Gene:mfsd14ba / 557306 ZFINID:ZDB-GENE-200414-1 Length:500 Species:Danio rerio


Alignment Length:465 Identity:99/465 - (21%)
Similarity:197/465 - (42%) Gaps:84/465 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 TKAMLTNAWFLQWENISAHVFPI-------------ILALFLGSFSDRRGRKLPLLMGLVGKFFY 161
            |..|||    :..|....|.|.|             :.|..:|:.||..||:..||:.:    |:
Zfish    67 TTPMLT----VLHETFPTHTFLINGLIQGVKGLLSFMSAPLIGALSDVWGRRSFLLVTV----FF 123

  Fly   162 STMIVVNARMTTWPVQNIIYSATLPSALTGADVAIFASCFAYISDISSLQQRTIRVTILDVIYLS 226
            :...:...|::.|     .|.|.:  :::||....|:..||||:|::..::|:....::...:.:
Zfish   124 TCAPIPLMRLSPW-----WYFAMI--SVSGAFSVTFSVIFAYIADVTDERERSTAYGLVSATFAA 181

  Fly   227 AMPMGVALGSHLFYNVFNQSYAD-MFTVNASLLALA-IIYTLCALKWQTTPRQRSLRELGCCGFW 289
            ::....|:|::|     :.||.| :..:.|:|:||| |.:.|.|:. ::.|.:..|...|....|
Zfish   182 SLVTSPAIGAYL-----SASYGDNLVVLVATLIALADICFILLAVP-ESLPDKMRLNTWGAPISW 240

  Fly   290 GDFFDKQHVKDSLAVLVKPRKGHRRSFLIILLVSMALYTFQRDEGQY--LYMYTLGKFDWDVSAY 352
                   ...|..|.|   ||..:.:.::::.:::.| ::..:.|||  .::|.....::.....
Zfish   241 -------EQADPFASL---RKVGQDTTVLLICITVFL-SYLPEAGQYSSFFLYLRQVINFSPKTI 294

  Fly   353 SNFKTFKSSAYVIAMLLAVPLMNKILGWRDTTIIFIGTWAHSIARLFFY-FATNTDLLYAGAVVC 416
            :.|........::|..|.:.|:.:.:|.::|.::.:|   ..|.:|.:| ..:...:::|...|.
Zfish   295 AVFIGVVGILSILAQTLFLTLLMRTIGNKNTVLLGLG---FQILQLAWYGLGSEPWMMWAAGAVA 356

  Fly   417 SLGPIVGPMIRAMTSKIVPTSERGKVFALLS----VCDNAVPF------------ISGVCYSQ-- 463
            ::..|..|.:.|:.|:.....::|.|..:::    :|:...|.            :||:...|  
Zfish   357 AMSSITFPAVSALVSRSADPDKQGLVQGMITGIRGLCNGLGPALYGFVFFLFNVELSGITPIQPD 421

  Fly   464 ----LYRRTQNTNHGGNVFILTIATQIAVFVMILCL--HIV-------LGKNSLAVPEVPEKESG 515
                :...|:.|...|..|:|...|.:..|::.|.:  |..       ..|||||.........|
Zfish   422 FAIPIQTPTEKTTIPGPPFLLGACTVVVAFIVALFIPDHSTPPSTPCQTRKNSLAGAHTNTPLPG 486

  Fly   516 LISQTEAVLE 525
            .....|.:||
Zfish   487 SDEDFEPLLE 496

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42514NP_730171.1 MFS_1 129..458 CDD:284993 72/362 (20%)
MFS 132..495 CDD:119392 82/402 (20%)
mfsd14baXP_002663499.2 MFS 52..409 CDD:119392 78/376 (21%)
MFS_1 54..398 CDD:284993 77/365 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D763423at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.