DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42514 and CG31321

DIOPT Version :9

Sequence 1:NP_730171.1 Gene:CG42514 / 8674108 FlyBaseID:FBgn0260388 Length:533 Species:Drosophila melanogaster
Sequence 2:NP_731899.1 Gene:CG31321 / 318681 FlyBaseID:FBgn0051321 Length:601 Species:Drosophila melanogaster


Alignment Length:602 Identity:129/602 - (21%)
Similarity:234/602 - (38%) Gaps:138/602 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 NSEDNENSASGTVREQRDEAAGRTVLQWAWHVVKSTSVEPTMFLYMFAFMITSVVEQNFFLYKSC 86
            :|.|...:.||.|    |........|..|.......:||..|.|..|.:..:|..|||.|.|:|
  Fly     6 SSADAAGNGSGAV----DAEPKLNYFQKLWRYRHYLVIEPFFFFYFMASVFNAVAMQNFPLDKAC 66

  Fly    87 RVNRNFTEEICRN-LNKPE------NEEFRT------------------------KAMLTNAWFL 120
            |||..:.:.:|.. |:|.|      :.:|..                        ||.| .|..|
  Fly    67 RVNLGYNKIVCDTMLDKSELGIECDDFDFENTTQGATPDLADLVIGATGFNYTVCKAEL-EAQIL 130

  Fly   121 QWENIS------AHVFPIILALFLGSFSDRRGRKLP-LLMGLVGK-FFYSTMIVVNARMTTWPVQ 177
            . .::|      |.:||:|:.||.|.::||..::.| ::|.::|: ..::..|:.:....:.|::
  Fly   131 A-ADVSGKRAPMAAIFPLIVLLFAGGWADRYNKRKPCMIMPIIGEALSFTCQIISSIFFESLPME 194

  Fly   178 NIIYSATLPSALTGADVAIFASCFAYISDISSLQQRTIRVTILDVIYLSAMP-MGVALGSHLFYN 241
            ...|...:..||.|.......:.::||:..:..:.|..|..|. .::::.:| :|..:...||..
  Fly   195 FGAYCEAIVPALFGGLTFCLMAIYSYITIATPEEDRVFRFGIF-AMFVTGVPFIGQPISGVLFTT 258

  Fly   242 V-FNQSYADMFTVNASLLALAIIYTLCALK---------------------------------WQ 272
            : :..|:|......    .:||.|.:..:|                                 ::
  Fly   259 LGYTWSFASAIVFQ----LIAIFYIIFFIKEVKTTPTTSTTANEPPPLPTSLPPKQQGADNMAYE 319

  Fly   273 TT---------------------------PRQRSLRELGCCGFWGDFFDKQHVKDSLAVLVKPRK 310
            ||                           |::..|:||         ||...|.|.:...:..|.
  Fly   320 TTNLDELQGNKNVNFQLTPQMEPKVEVVPPKRSLLKEL---------FDPTLVLDCIRFPLVKRP 375

  Fly   311 GHRRSFLIILLVSMALYTFQRD-EGQYLYMYTLGKFDWDVSAYSNFKTFKSSAYVIAMLLAVPLM 374
            .:.|..||:||.:..|...... |..|.|.:||.|..|:.:.:|.:.|..|.|.::...:...::
  Fly   376 NNGRMLLILLLCAYFLTVGPTSGENDYWYRFTLKKLAWNGNDFSIYLTLSSGAALVGTFIGTAIL 440

  Fly   375 NKILGWRDTTIIFIGTWAHSIARLFFYFATNTDLLYAGAVV---CSLGPIVGPMIRAMTSKIVPT 436
            :|:|...|:.|..:...:...:|:.|.|:::|...|...||   .||..|.   |:.:.|.||..
  Fly   441 SKLLKVSDSMIGMLSALSIVCSRVLFAFSSSTASFYVAGVVDMFVSLRVIA---IKTIGSSIVAG 502

  Fly   437 SERGKVFALLSVCDNAVPFISGVCYSQLYRRTQNTNHG-----GNVFILTIATQIAVFVMILCLH 496
            .|..|::::..:.:....||....:|::|:.|.::..|     |.:|.:.     .|.|.::|..
  Fly   503 DELSKMYSIFGISEPIAQFIFPPIFSEIYKSTVDSFPGAIWLFGEIFYIP-----NVLVFVVCYF 562

  Fly   497 IVLGKNSLAVPEVPEKE 513
            ::..:.:.....|.|.|
  Fly   563 LLRRRKANEEKSVVEME 579

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42514NP_730171.1 MFS_1 129..458 CDD:284993 82/396 (21%)
MFS 132..495 CDD:119392 88/435 (20%)
CG31321NP_731899.1 MFS 141..>271 CDD:119392 29/130 (22%)
MFS_1 143..>271 CDD:284993 28/128 (22%)
MFS <379..559 CDD:119392 47/187 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45458944
Domainoid 1 1.000 91 1.000 Domainoid score I4859
eggNOG 1 0.900 - - E1_KOG2816
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 74 1.000 Inparanoid score I1664
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D333052at33208
OrthoFinder 1 1.000 - - FOG0001349
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23507
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.900

Return to query results.
Submit another query.